IL10RA (NM_001558) Human Tagged ORF Clone

CAT#: RC207020

Reviews ()
Write a review

IL10RA (Myc-DDK-tagged)-Human interleukin 10 receptor, alpha (IL10RA), transcript variant 1



  "NM_001558" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IL10RA
Synonyms CD210; CD210a; CDW210A; HIL-10R; IL-10R1; IL10R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207020 representing NM_001558
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCGTGCCTCGTAGTGCTGCTGGCGGCGCTCCTCAGCCTCCGTCTTGGCTCAGACGCTCATGGGA
CAGAGCTGCCCAGCCCTCCGTCTGTGTGGTTTGAAGCAGAATTTTTCCACCACATCCTCCACTGGACACC
CATCCCAAATCAGTCTGAAAGTACCTGCTATGAAGTGGCACTCCTGAGGTATGGAATAGAGTCCTGGAAC
TCCATCTCCAACTGTAGCCAGACCCTGTCCTATGACCTTACCGCAGTGACCTTGGACCTGTACCACAGCA
ATGGCTACCGGGCCAGAGTGCGGGCTGTGGACGGCAGCCGGCACTCCAACTGGACCGTCACCAACACCCG
CTTCTCTGTGGATGAAGTGACTCTGACAGTTGGCAGTGTGAACCTAGAGATCCACAATGGCTTCATCCTC
GGGAAGATTCAGCTACCCAGGCCCAAGATGGCCCCCGCAAATGACACATATGAAAGCATCTTCAGTCACT
TCCGAGAGTATGAGATTGCCATTCGCAAGGTGCCGGGAAACTTCACGTTCACACACAAGAAAGTAAAACA
TGAAAACTTCAGCCTCCTAACCTCTGGAGAAGTGGGAGAGTTCTGTGTCCAGGTGAAACCATCTGTCGCT
TCCCGAAGTAACAAGGGGATGTGGTCTAAAGAGGAGTGCATCTCCCTCACCAGGCAGTATTTCACCGTGA
CCAACGTCATCATCTTCTTTGCCTTTGTCCTGCTGCTCTCCGGAGCCCTCGCCTACTGCCTGGCCCTCCA
GCTGTATGTGCGGCGCCGAAAGAAGCTACCCAGTGTCCTGCTCTTCAAGAAGCCCAGCCCCTTCATCTTC
ATCAGCCAGCGTCCCTCCCCAGAGACCCAAGACACCATCCACCCGCTTGATGAGGAGGCCTTTTTGAAGG
TGTCCCCAGAGCTGAAGAACTTGGACCTGCACGGCAGCACAGACAGTGGCTTTGGCAGCACCAAGCCATC
CCTGCAGACTGAAGAGCCCCAGTTCCTCCTCCCTGACCCTCACCCCCAGGCTGACAGAACGCTGGGAAAC
GGGGAGCCCCCTGTGCTGGGGGACAGCTGCAGTAGTGGCAGCAGCAATAGCACAGACAGCGGGATCTGCC
TGCAGGAGCCCAGCCTGAGCCCCAGCACAGGGCCCACCTGGGAGCAACAGGTGGGGAGCAACAGCAGGGG
CCAGGATGACAGTGGCATTGACTTAGTTCAAAACTCTGAGGGCCGGGCTGGGGACACACAGGGTGGCTCG
GCCTTGGGCCACCACAGTCCCCCGGAGCCTGAGGTGCCTGGGGAAGAAGACCCAGCTGCTGTGGCATTCC
AGGGTTACCTGAGGCAGACCAGATGTGCTGAAGAGAAGGCAACCAAGACAGGCTGCCTGGAGGAAGAATC
GCCCTTGACAGATGGCCTTGGCCCCAAATTCGGGAGATGCCTGGTTGATGAGGCAGGCTTGCATCCACCA
GCCCTGGCCAAGGGCTATTTGAAACAGGATCCTCTAGAAATGACTCTGGCTTCCTCAGGGGCCCCAACGG
GACAGTGGAACCAGCCCACTGAGGAATGGTCACTCCTGGCCTTGAGCAGCTGCAGTGACCTGGGAATATC
TGACTGGAGCTTTGCCCATGACCTTGCCCCTCTAGGCTGTGTGGCAGCCCCAGGTGGTCTCCTGGGCAGC
TTTAACTCAGACCTGGTCACCCTGCCCCTCATCTCTAGCCTGCAGTCAAGTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207020 representing NM_001558
Red=Cloning site Green=Tags(s)

MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWN
SISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFIL
GKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVA
SRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIF
ISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGN
GEPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPP
ALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGS
FNSDLVTLPLISSLQSSE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001558
ORF Size 1734 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001558.4
RefSeq Size 3649 bp
RefSeq ORF 1737 bp
Locus ID 3587
UniProt ID Q13651
Cytogenetics 11q23.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 62.9 kDa
Gene Summary The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. [provided by RefSeq, Jan 2009]

Other Versions

Other products for "IL10RA"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


IL10RA mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
    • 100 ul

USD 446.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.