CA5B (NM_007220) Human Tagged ORF Clone

CAT#: RC207002

CA5B (Myc-DDK-tagged)-Human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein

Product Images

Circular map for RC207002

• 

  Western blot validation of overexpression lysate (Cat# LY416110) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC207002 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CA5B protein (Cat# TP307002). The protein was produced from HEK293T cells transfected with CA5B cDNA clone (Cat# RC207002) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CA5B
• Synonyms: CA-VB; CAVB
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC207002 representing NM_007220
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCGGCGC
  GCCC
  
  ATGGTGGTGATGAACAGCCTGAGGGTCATTCTTCAAGCCTCTCCAGGCAAATTGCTGTGGAGAAAGTTCC
  AGATTCCGAGATTCATGCCAGCGAGGCCCTGCAGCCTCTATACTTGTACTTACAAAACCCGGAACCGAGC
  CTTGCATCCACTCTGGGAGAGCGTGGACCTGGTTCCTGGGGGCGATCGCCAGTCACCCATCAACATTCGG
  TGGAGGGACAGTGTTTATGATCCCGGCTTAAAACCACTGACCATCTCTTATGACCCAGCCACCTGCCTCC
  ACGTCTGGAATAATGGGTACTCTTTCCTCGTGGAATTTGAAGATTCTACAGATAAATCAGTGATCAAGGG
  AGGACCCCTGGAACACAACTACCGATTGAAGCAGTTCCATTTTCACTGGGGGGCCATCGATGCCTGGGGT
  TCTGAGCACACCGTGGACAGCAAATGCTTCCCAGCAGAGCTGCACTTAGTGCATTGGAACGCAGTCAGAT
  TTGAAAACTTTGAGGATGCAGCACTGGAAGAAAATGGTTTGGCTGTGATAGGAGTATTTTTAAAGCTAGG
  CAAACATCATAAGGAGCTACAGAAATTAGTGGATACTTTGCCGTCAATTAAGCATAAGGACGCCCTTGTG
  GAATTTGGGTCATTTGACCCTTCCTGCCTGATGCCTACCTGCCCAGATTACTGGACCTACTCAGGGTCTC
  TGACTACCCCACCCCTCTCCGAGTCTGTCACCTGGATCATTAAGAAGCAACCAGTAGAGGTTGATCATGA
  TCAGCTTGAGCAATTTCGGACCCTGCTTTTCACTTCCGAAGGGGAGAAAGAGAAAAGAATGGTGGACAAC
  TTCCGCCCCCTTCAGCCACTGATGAATCGCACTGTTCGTTCATCCTTCCGGCATGATTATGTGCTGAATG
  TACAAGCGAAACCCAAGCCGGCCACCAGCCAAGCAACCCCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC207002 representing NM_007220
  Red=Cloning site Green=Tags(s)
  
  MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIR
  WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWG
  SEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALV
  EFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDN
  FRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
  
  myc-FLAG tag
• Restriction Sites: AscI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_007220
• ORF Size: 951 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_007220.4
• RefSeq Size: 6032 bp
• RefSeq ORF: 954 bp
• Locus ID: 11238
• UniProt ID: Q9Y2D0
• Cytogenetics: Xp22.2
• Domains: carb_anhydrase
• Protein Families: Druggable Genome
• Protein Pathways: Nitrogen metabolism
• MW: 36.43 kDa
• Gene Summary: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes carbonic anhydrase 5B. CA5B, and the related CA5A gene, has its expression localized in the mitochondria though CA5B has a wider tissue distribution than CA5A, which is restricted to the liver, kidneys, and skeletal muscle. A carbonic anhydrase pseudogene (CA5BP1) is adjacent to the CA5B gene and these two loci produce CA5BP1-CA5B readthrough transcripts. [provided by RefSeq, Jan 2019]