TMEM63A (NM_014698) Human Tagged ORF Clone

CAT#: RC206992

Reviews ()
Write a review

TMEM63A (Myc-DDK-tagged)-Human transmembrane protein 63A (TMEM63A)



Reconstitution Protocol

USD 739.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TMEM63A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TMEM63A
Synonyms HLD19; KIAA0792
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206992 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGACTCCCCGTTCCTGGAGCTGTGGCAGTCCAAGGCAGTGTCCATCAGGGAGCAGCTGGGACTCG
GGGACCGGCCCAACGACTCCTATTGCTACAACTCGGCCAAAAACAGCACCGTGCTCCAGGGGGTCACCTT
TGGTGGCATCCCCACTGTCCTGCTCATAGACGTCAGCTGCTTCCTGTTCTTAATCTTGGTGTTTTCTATT
ATAAGAAGAAGATTCTGGGACTATGGCCGCATTGCCCTGGTGTCAGAAGCAGACAGCGAGTCCAGATTTC
AGAGATTGTCATCGACTTCCTCCTCAGGTCAACAAGACTTTGAAAATGAGCTGGGATGCTGTCCCTGGCT
GACTGCCATCTTCCGTCTGCATGATGACCAGATCCTGGAATGGTGTGGGGAGGACGCCATCCACTACCTG
TCCTTCCAGAGGCACATCATCTTCCTGTTGGTGGTGGTCAGCTTTTTGTCCCTGTGTGTCATCCTGCCTG
TCAACCTCTCAGGGGACTTGCTGGACAAAGACCCGTATAGTTTTGGGAGGACAACAATAGCAAACCTACA
GACTGACAATGACCTCCTTTGGCTGCACACCATCTTTGCTGTCATTTACCTCTTCCTCACTGTGGGTTTC
ATGCGGCACCACACTCAGTCCATTAAGTACAAAGAGGAGAACCTGGTGAGGCGGACCCTGTTCATCACAG
GACTCCCCAGAGATGCCAGGAAGGAGACTGTGGAGAGCCACTTCCGGGACGCGTATCCCACGTGTGAGGT
GGTTGATGTGCAGCTGTGCTACAACGTGGCCAAACTGATCTACCTGTGCAAGGAGAAAAAGAAGACTGAG
AAGAGCCTGACCTATTACACAAACCTGCAGGTGAAGACAGGCCAGCGGACCCTCATCAACCCCAAGCCCT
GTGGCCAGTTTTGCTGCTGTGAAGTGCTGGGCTGTGAGTGGGAAGACGCCATCTCTTACTACACACGGAT
GAAGGACAGGCTGCTGGAGAGGATCACAGAGGAAGAACGCCACGTCCAGGACCAGCCCCTGGGAATGGCC
TTCGTCACCTTCCAGGAGAAGTCCATGGCCACCTACATCCTGAAAGATTTCAATGCCTGCAAGTGTCAGA
GCCTTCAGTGCAAAGGTGAGCCCCAGCCGTCCTCCCATAGCAGGGAGCTCTATACCTCCAAGTGGACAGT
CACCTTTGCTGCTGACCCTGAGGACATCTGCTGGAAGAACCTCTCTATCCAGGGCCTCCGCTGGTGGCTA
CAGTGGCTGGGCATCAACTTCACCCTCTTCCTGGGGCTATTTTTCCTGACCACACCCTCCATCATCCTGT
CCACCATGGACAAGTTTAATGTCACCAAACCCATCCATGCGCTGAATAACCCGATCATCAGCCAGTTCTT
CCCCACCCTCCTGCTCTGGTCCTTCTCGGCCCTGCTCCCCTCCATTGTCTACTACTCTACACTGCTGGAG
TCTCACTGGACCAAGTCGGGGGAAAACCAGATCATGATGACCAAAGTCTACATATTCTTGATCTTCATGG
TGCTGATCCTGCCCTCCCTGGGTCTCACCAGTCTAGATTTTTTCTTCCGGTGGCTCTTTGACAAAACTTC
CTCGGAGGCCTCCATCAGGTTGGAGTGCGTCTTCCTGCCTGACCAGGGTGCCTTCTTTGTGAACTATGTC
ATCGCCTCGGCCTTCATCGGCAATGGCATGGAGCTGCTGCGGCTGCCAGGTCTCATCCTCTATACCTTCC
GCATGATCATGGCCAAGACGGCTGCTGACCGCAGGAATGTCAAGCAGAACCAGGCCTTCCAGTACGAGTT
TGGAGCCATGTATGCATGGATGCTGTGTGTCTTCACTGTCATCGTGGCCTACAGCATCACTTGTCCCATC
ATCGCGCCATTTGGCCTCATCTACATCCTGCTCAAGCACATGGTGGACCGGCACAACCTCTACTTCGTCT
ACCTCCCAGCCAAGCTGGAGAAGGGGATCCACTTTGCCGCTGTGAACCAGGCCTTGGCAGCCCCCATCCT
GTGCCTCTTCTGGCTCTACTTCTTTTCCTTCCTGCGCCTGGGTATGAAGGCCCCCGCCACTCTGTTCACC
TTCCTGGTGCTGCTGCTCACCATCCTGGTCTGCCTGGCTCACACCTGCTTTGGATGCTTCAAGCACCTCA
GCCCTCTGAACTACAAAACAGAAGAGCCTGCAAGTGACAAAGGAAGTGAGGCAGAGGCCCACATGCCCCC
ACCGTTCACACCCTACGTGCCTCGGATTCTGAACGGCTTGGCCTCGGAGAGGACAGCACTGTCTCCGCAG
CAGCAGCAGCAGCAGACCTATGGTGCCATCCACAACATCAGCGGGACTATCCCTGGACAGTGCTTGGCGC
AGAGCGCCACGGGCAGTGTGGCTGCTGCCCCCCAGGAGGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC206992 protein sequence
Red=Cloning site Green=Tags(s)

MMDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFLFLILVFSI
IRRRFWDYGRIALVSEADSESRFQRLSSTSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYL
SFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGRTTIANLQTDNDLLWLHTIFAVIYLFLTVGF
MRHHTQSIKYKEENLVRRTLFITGLPRDARKETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTE
KSLTYYTNLQVKTGQRTLINPKPCGQFCCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMA
FVTFQEKSMATYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWL
QWLGINFTLFLGLFFLTTPSIILSTMDKFNVTKPIHALNNPIISQFFPTLLLWSFSALLPSIVYYSTLLE
SHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEASIRLECVFLPDQGAFFVNYV
IASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYSITCPI
IAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAAPILCLFWLYFFSFLRLGMKAPATLFT
FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTALSPQ
QQQQQTYGAIHNISGTIPGQCLAQSATGSVAAAPQEA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014698
ORF Size 2421 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014698.3
RefSeq Size 4469 bp
RefSeq ORF 2424 bp
Locus ID 9725
UniProt ID O94886
Cytogenetics 1q42.12
Domains DUF221
Protein Families Transmembrane
MW 92.1 kDa
Gene Summary Acts as an osmosensitive calcium-permeable cation channel.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.