BANK1 (NM_017935) Human Tagged ORF Clone

CAT#: RC206985

BANK1 (Myc-DDK-tagged)-Human B-cell scaffold protein with ankyrin repeats 1 (BANK1), transcript variant 1

Change vector?

  • TrueORF®

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BANK1 (NM_017935) Human Tagged ORF Clone
Symbol BANK1
Synonyms BANK; BANK
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206985 representing NM_017935
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCAGCAGCGCCAGGCAAGGGGCTTGGGAGCCCGGACCCCGCCCCCTGCGGCCCAGCGCCCCCAG
GAAATACAAAAGATATAATAATGATATATGAAGAAGATGCTGAGGAATGGGCTCTGTACTTGACAGAAGT
ATTTTTACATGTTGTGAAAAGGGAAGCCATCCTGTTATATCGCTTGGAGAATTTCTCTTTTCGGCATTTG
GAGTTGCTGAACTTAACGTCTTACAAATGTAAACTTTTGATATTATCAAATAGCCTGCTTAGAGACCTAA
CTCCAAAGAAATGTCAGTTTCTGGAAAAGATACTTCATTCACCAAAAAGTGTAGTTACTTTGCTTTGTGG
AGTGAAGAGTTCAGATCAGCTCTATGAATTACTAAATATCTCTCAAAGCAGATGGGAGATCTCAACTGAA
CAGGAACCTGAAGACTACATCTCTGTAATCCAGAGTATCATATTCAAAGATTCTGAAGACTACTTTGAGG
TCAACATTCCAACAGACCTACGAGCAAAACATTCTGGGGAAATAAGTGAGAGAAAGGAAATTGAAGAACT
ATCAGAAGCTTCAAGAAACACCATACCACTAGCAGTGGTGCTTCCCACTGAAATTCCATGTGAGAATCCT
GGTGAAATATTCATAATTTTGAGAGATGAAGTAATTGGTGATACTGTAGAGGTTGAATTTACATCAAGTA
ATAAGCGCATTAGAACACGGCCAGCCCTTTGGAATAAGAAAGTCTGGTGCATGAAAGCTTTAGAGTTTCC
TGCTGGTTCAGTCCATGTCAATGTCTACTGTGATGGAATCGTTAAAGCTACAACCAAAATTAAGTACTAC
CCAACAGCAAAGGCAAAGGAATGCCTATTCAGAATGGCAGATTCAGGAGAGAGTTTGTGCCAGAATAGCA
TTGAAGAACTTGATGGTGTCCTTACATCCATATTCAAACATGAGATACCATATTATGAGTTCCAGTCTCT
TCAAACTGAAATTTGTTCTCAAAACAAATATACTCATTTCAAAGAACTTCCAACTCTTCTCCACTGTGCA
GCAAAATTTGGCTTAAAGAACCTGGCTATTCATTTGCTTCAATGTTCAGGAGCAACCTGGGCATCTAAGA
TGAAAAATATGGAGGGTTCAGACCCCGCACATATTGCTGAAAGGCATGGTCACAAAGAACTCAAGAAAAT
CTTCGAAGACTTTTCAATCCAAGAAATTGACATAAATAATGAGCAAGAAAATGATTATGAAGAGGATATT
GCCTCATTTTCCACATATATTCCTTCCACACAGAACCCAGCATTTCATCATGAAAGCAGAAAGACATACG
GGCAGAGTGCAGATGGAGCTGAGGCAAATGAAATGGAAGGGGAAGGAAAACAGAATGGATCAGGCATGGA
GACCAAACACAGCCCACTAGAGGTTGGCAGTGAGAGTTCTGAAGACCAGTATGATGACTTGTATGTGTTC
ATTCCTGGTGCTGATCCAGAAAATAATTCACAAGAGCCACTCATGAGCAGCAGACCTCCTCTCCCCCCGC
CGCGACCTGTAGCTAATGCCTTCCAACTGGAAAGACCTCACTTCACCTTACCAGGGACAATGGTGGAAGG
CCAAATGGAAAGAAGTCAAAACTGGGGTCATCCTGGTGTTAGACAAGAAACAGGAGATGAACCCAAAGGA
GAAAAAGAGAAGAAAGAAGAGGAAAAAGAGCAGGAGGAGGAAGAAGACCCATATACTTTTGCTGAGATTG
ATGACAGTGAATATGACATGATATTGGCCAATCTGAGTATAAAGAAAAAAACTGGGAGTCGGTCTTTCAT
TATAAATAGACCTCCTGCCCCCACACCCCGACCCACAAGTATACCTCCAAAAGAGGAAACTACACCTTAC
ATAGCTCAAGTGTTTCAACAAAAGACAGCCAGAAGACAATCTGATGATGACAAGTTCCGTGGTCTTCCTA
AGAAACAAGACAGAGCTCGGATAGAGAGTCCAGCCTTTTCTACTCTCAGGGGCTGTCTAACTGATGGTCA
GGAAGAACTCATCCTCCTGCAGGAGAAAGTAAAGAATGGGAAAATGTCTATGGATGAAGCTCTGGAGAAA
TTTAAACACTGGCAGATGGGAAAAAGTGGCCTGGAAATGATTCAGCAGGAGAAATTACGACAACTACGAG
ACTGCATTATTGGGAAAAGGCCAGAAGAAGAAAATGTCTATAATAAACTCACCATTGTGCACCATCCAGG
TGGTAAGGAAACTGCCCACAATGAAAATAAGTTTTATAATGTACACTTCAGCAATAAGCTTCCTACTCGA
CCCCAAGTTGAAAAGGAATTTGGTTTCTGTTGCAAGAAAGATCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206985 representing NM_017935
Red=Cloning site Green=Tags(s)

MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLYRLENFSFRHL
ELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKSSDQLYELLNISQSRWEISTE
QEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISERKEIEELSEASRNTIPLAVVLPTEIPCENP
GEIFIILRDEVIGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYY
PTAKAKECLFRMADSGESLCQNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCA
AKFGLKNLAIHLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESSEDQYDDLYVF
IPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQMERSQNWGHPGVRQETGDEPKG
EKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPY
IAQVFQQKTARRQSDDDKFRGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEK
FKHWQMGKSGLEMIQQEKLRQLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPTR
PQVEKEFGFCCKKDH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017935
ORF Size 2355 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017935.2, NM_017935.3, NM_017935.4, NP_060405
RefSeq Size 3239
RefSeq ORF 2358
Locus ID 55024
Cytogenetics 4q24
MW 89.2 kDa
Gene Summary The protein encoded by this gene is a B-cell-specific scaffold protein that functions in B-cell receptor-induced calcium mobilization from intracellular stores. This protein can also promote Lyn-mediated tyrosine phosphorylation of inositol 1,4,5-trisphosphate receptors. Polymorphisms in this gene are associated with susceptibility to systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations