INPP5E (NM_019892) Human Tagged ORF Clone

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name INPP5E (NM_019892) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol INPP5E
Synonyms CORS1; CPD4; JBTS1; MORMS; pharbin; PPI5PIV
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC206984 representing NM_019892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCCAAGGCGGAGAATCTGCGGCCCTCCGAGCCGGCCCCGCAGCCGCCGGAAGGGAGGACGCTCC
AAGGACAGCTTCCCGGCGCTCCGCCGGCCCAGCGCGCGGGGTCCCCACCCGATGCTCCGGGCTCCGAGAG
CCCCGCGCTTGCCTGCAGCACTCCGGCCACGCCCAGCGGCGAGGACCCGCCAGCCCGAGCAGCACCCATC
GCCCCGCGGCCCCCCGCCAGGCCTCGACTGGAGCGAGCCCTGTCCCTGGACGACAAGGGCTGGAGGAGGA
GGCGTTTTCGAGGCAGCCAGGAGGACCTGGAAGCCCGGAATGGGACCAGTCCCTCCAGGGGCTCAGTGCA
GAGCGAGGGCCCCGGGGCCCCCGCCCACAGCTGCTCCCCGCCCTGCCTGAGCACCTCCTTGCAGGAAATC
CCCAAGTCCCGCGGGGTCCTGAGCAGTGAGAGAGGGAGCCCGTCCTCGGGGGGTAACCCTCTCTCTGGGG
TGGCCAGCAGCTCCCCGAACCTCCCGCACAGAGACGCCGCCGTGGCGGGGAGCTCGCCCAGGCTGCCCAG
CCTGCTGCCCCCGCGCCCACCGCCTGCCCTGAGCCTGGACATCGCCTCCGACTCCCTGAGGACAGCAAAC
AAGGTCGACTCGGATCTTGCAGACTACAAGCTCCGCGCGCAGCCGCTCCTGGTGCGGGCCCACAGCAGCC
TGGGCCCCGGCCGGCCGCGGAGCCCCCTGGCCTGCGACGACTGTTCCCTTCGCTCGGCCAAATCCTCCTT
CAGCCTCCTGGCGCCCATCCGCAGCAAGGACGTCCGCAGCAGGAGTTACCTGGAGGGCAGCCTCCTGGCC
AGCGGGGCCCTGTTGGGGGCGGATGAGCTGGCCCGCTACTTCCCAGACCGGAACGTGGCACTCTTCGTGG
CCACCTGGAACATGCAGGGCCAGAAGGAGCTCCCGCCCAGCCTGGACGAGTTCCTGCTCCCAGCCGAGGC
CGACTATGCCCAGGACCTGTATGTCATCGGGGTCCAGGAGGGCTGTTCTGACAGGCGGGAGTGGGAGACT
CGTCTGCAGGAGACGCTGGGCCCGCACTATGTGCTGCTGTCCTCGGCGGCCCACGGCGTGCTCTACATGT
CGCTCTTCATCCGCAGGGACCTCATCTGGTTCTGCTCAGAGGTGGAGTGCTCCACGGTGACCACACGCAT
CGTGTCTCAGATCAAGACCAAGGGGGCCTTGGGCATCAGCTTCACCTTTTTTGGCACTTCCTTCCTCTTC
ATCACGTCCCACTTCACCTCAGGTGACGGGAAGGTGGCGGAGCGGCTGCTGGACTACACCAGGACTGTAC
AAGCCCTGGTCCTGCCCAGAAATGTGCCCGACACCAACCCCTATCGCTCCAGCGCAGCGGACGTCACCAC
CCGCTTCGATGAGGTGTTCTGGTTTGGAGACTTCAACTTCCGCCTGAGTGGCGGGCGCACAGTCGTGGAC
GCCCTCCTGTGCCAGGGCCTGGTGGTGGACGTGCCGGCGCTGCTGCAGCACGACCAGCTCATCCGGGAGA
TGCGGAAAGGGTCCATCTTCAAGGGCTTCCAGGAGCCGGACATCCACTTCCTCCCATCATACAAGTTTGA
CATCGGGAAGGACACGTACGACAGCACCTCCAAGCAGAGGACGCCCTCATACACGGACCGCGTCTTGTAC
AGAAGCCGCCACAAGGGTGACATCTGTCCTGTGAGCTACTCTTCCTGCCCCGGGATCAAGACGTCCGACC
ACCGCCCTGTGTATGGCCTCTTCCGGGTGAAAGTGAGGCCGGGGCGAGACAACATTCCGTTGGCAGCTGG
CAAATTTGATAGAGAACTGTACTTACTAGGAATTAAAAGACGGATTTCGAAGGAGATTCAGAGGCAGCAA
GCACTACAGAGTCAGAACTCCAGCACCATCTGCTCCGTTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206984 representing NM_019892
Red=Cloning site Green=Tags(s)

MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSGEDPPARAAPI
APRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEGPGAPAHSCSPPCLSTSLQEI
PKSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAGSSPRLPSLLPPRPPPALSLDIASDSLRTAN
KVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLA
SGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET
RLQETLGPHYVLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLF
ITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNFRLSGGRTVVD
ALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLY
RSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQ
ALQSQNSSTICSVS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019892
ORF Size 1932 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019892.1, NM_019892.2, NM_019892.3, NM_019892.4, NM_019892.5, NP_063945.2
RefSeq Size 3440
RefSeq ORF 1935
Locus ID 56623
Cytogenetics 9q34.3
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
MW 70 kDa
Gene Summary The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. Studies of the mouse counterpart suggest that this protein may hydrolyze phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,5-bisphosphate on the cytoplasmic Golgi membrane and thereby regulate Golgi-vesicular trafficking. Mutations in this gene cause Joubert syndrome; a clinically and genetically heterogenous group of disorders characterized by midbrain-hindbrain malformation and various associated ciliopathies that include retinal dystrophy, nephronophthisis, liver fibrosis and polydactyly. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

Other Versions

Other products for "INPP5E"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools