STK33 (NM_030906) Human Tagged ORF Clone

CAT#: RC206910

STK33 (Myc-DDK-tagged)-Human serine/threonine kinase 33 (STK33)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name STK33 (NM_030906) Human Tagged ORF Clone
Symbol STK33
Synonyms OTTHUMP00000178934; OTTHUMP00000178935; serine/threonine kinase 33
Vector pCMV6-Entry
Sequence Data
>RC206910 representing NM_030906
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGATAGTGGCTTAGATAAAAAATCCACAAAATGCCCCGACTGTTCATCTGCTTCTCAGAAAGATG
TACTTTGTGTATGTTCCAGCAAAACAAGGGTTCCTCCAGTTTTGGTGGTGGAAATGTCACAGACATCAAG
CATTGGTAGTGCAGAATCTTTAATTTCACTGGAGAGAAAAAAAGAAAAAAATATCAACAGAGATATAACC
TCCAGGAAAGATTTGCCCTCAAGAACCTCAAATGTAGAGAGAAAAGCATCTCAGCAACAATGGGGTCGGG
GCAACTTTACAGAAGGAAAAGTTCCTCACATAAGGATTGAGAATGGAGCTGCTATTGAGGAAATCTATAC
CTTTGGAAGAATATTGGGAAAAGGGAGCTTTGGAATAGTCATTGAAGCTACAGACAAGGAAACAGAAACG
AAGTGGGCAATTAAAAAAGTGAACAAAGAAAAGGCTGGAAGCTCCGCTGTGAAGTTACTTGAACGAGAGG
TGAACATTCTGAAAAGTGTAAAACATGAACACATCATACATCTGGAACAAGTATTTGAAACGCCAAAGAA
AATGTACCTTGTGATGGAGCTTTGTGAGGATGGAGAACTCAAAGAAATTCTGGATAGGAAAGGGCATTTC
TCAGAGAATGAGACAAGGTGGATCATTCAAAGTCTCGCATCAGCTATAGCATATCTTCACAATAATGATA
TTGTACATAGGGATCTGAAACTGGAAAATATAATGGTTAAAAGCAGTCTTATTGATGATAACAATGAAAT
AAACTTAAACATAAAGGTGACTGATTTTGGCTTAGCGGTGAAGAAGCAAAGTAGGAGTGAAGCCATGCTG
CAGGCCACATGTGGGACTCCTATCTATATGGCCCCTGAAGTTATCAGTGCCCACGACTATAGCCAGCAGT
GTGACATTTGGAGCATAGGCGTCGTAATGTACATGTTATTACGTGGAGAACCACCCTTTTTGGCAAGCTC
AGAAGAGAAGCTTTTTGAGTTAATAAGAAAAGGAGAACTACATTTTGAAAATGCAGTCTGGAATTCCATA
AGTGACTGTGCTAAAAGTGTTTTGAAACAACTTATGAAAGTAGATCCTGCTCACAGAATCACAGCTAAGG
AACTACTAGATAACCAGTGGTTAACAGGCAATAAACTTTCTTCGGTGAGACCAACCAATGTATTAGAGAT
GATGAAGGAATGGAAAAATAACCCAGAAAGTGTTGAGGAAAACACAACAGAAGAGAAGAATAAGCCGTCC
ACTGAAGAAAAGTTGAAAAGTTACCAACCCTGGGGAAATGTCCCTGAGACCAATTACACTTCAGATGAAG
AGGAGGAAAAACAGTCTACTACTTATGAAAAGCAATTTCCTGCAACCAGTAAGGACAACTTTGATATGTG
CAGTTCAAGTTTCACATCTAGCAAACTCCTTCCAGCTGAAATCAAGGGAGAAATGGAGAAAACCCCTGTG
ACTCCAAGCCAAGGAACAGCAACCAAGTACCCTGCTAAATCCGGCGCCCTGTCCAGAACCAAAAAGAAAC
TC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206910 representing NM_030906
Red=Cloning site Green=Tags(s)

MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDIT
SRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGRILGKGSFGIVIEATDKETET
KWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQVFETPKKMYLVMELCEDGELKEILDRKGHF
SENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAML
QATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSI
SDCAKSVLKQLMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS
TEEKLKSYQPWGNVPETNYTSDEEEEKQSTTYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPV
TPSQGTATKYPAKSGALSRTKKKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030906
ORF Size 1542 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030906.1, NM_030906.2, NM_030906.3, NP_112168
RefSeq Size 2707
RefSeq ORF 1545
Locus ID 65975
Cytogenetics 11p15.4
Protein Families Protein Kinase, Druggable Genome
MW 57.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)