CALHM1 (NM_001001412) Human Tagged ORF Clone

CAT#: RC206902

CALHM1 (Myc-DDK-tagged)-Human calcium homeostasis modulator 1 (CALHM1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CALHM1 (NM_001001412) Human Tagged ORF Clone
Symbol CALHM1
Synonyms FAM26C; FAM26C
Vector pCMV6-Entry
Sequence Data
>RC206902 representing NM_001001412
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGACAAGTTCCGGATGATCTTCCAGTTCCTGCAGTCCAACCAGGAGTCCTTCATGAATGGCATCT
GTGGCATCATGGCCCTGGCCAGTGCCCAGATGTACTCGGCCTTCGACTTCAACTGCCCCTGCCTGCCGGG
CTACAATGCGGCCTACAGCGCGGGCATCCTGCTGGCGCCACCCCTGGTGCTCTTTCTGCTTGGCCTGGTC
ATGAACAACAACGTGTCCATGCTGGCCGAAGAGTGGAAGCGGCCACCGGGCCGCCGGGCCAAGGACCCCG
CTGTGTTGCGCTACATGTTCTGCTCCATGGCCCAGCGCGCCCTCATCGCGCCTGTCGTCTGGGTGGCCGT
CACGCTACTCGACGGCAAATGCTTCCTCTGTGCCTTCTGCACTGCCGTGCCCGTGAGCGCACTGGGCAAC
GGCAGCCTGGCACCCGGCCTTCCTGCCCCCGAGCTCGCCCGCCTGCTGGCCCGGGTGCCCTGCCCTGAGA
TCTACGATGGCGACTGGCTGTTGGCCCGAGAGGTGGCCGTGCGTTACCTCCGCTGCATCTCCCAGGCGCT
GGGCTGGTCCTTCGTGCTGCTGACCACTCTGCTGGCATTCGTGGTGCGCTCTGTGCGGCCCTGCTTCACG
CAGGCCGCCTTCCTCAAGAGCAAGTACTGGTCCCACTATATCGACATCGAGCGCAAGCTCTTCGACGAGA
CGTGCACGGAGCACGCCAAAGCCTTTGCCAAGGTCTGCATCCAGCAGTTCTTCGAGGCCATGAACCATGA
CCTGGAGCTGGGTCACACCAACGGGACACTGGCCACGGCCCCTGCTTCCGCAGCTGCCCCCACGACCCCC
GATGGTGCGGAGGAGGAAAGGGAGAAGCTGCGTGGCATCACGGATCAAGGCACCATGAACAGGCTGCTCA
CGAGCTGGCACAAATGCAAACCGCCTCTGCGGCTGGGCCAGGAGGAGCCACCGCTGATGGGCAACGGCTG
GGCTGGGGGTGGGCCCCGGCCTCCGCGTAAGGAGGTGGCCACCTACTTCAGCAAAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206902 representing NM_001001412
Red=Cloning site Green=Tags(s)

MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAPPLVLFLLGLV
MNNNVSMLAEEWKRPPGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVSALGN
GSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYLRCISQALGWSFVLLTTLLAFVVRSVRPCFT
QAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTP
DGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001001412
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001001412.1, NM_001001412.2, NM_001001412.3, NP_001001412
RefSeq Size 3099
RefSeq ORF 1041
Locus ID 255022
Cytogenetics 10q24.33
Protein Families Transmembrane
MW 38.1 kDa
Gene Summary This gene encodes a calcium channel that plays a role in processing of amyloid-beta precursor protein. A polymorphism at this locus has been reported to be associated with susceptibility to late-onset Alzheimer's disease in some populations, but the pathogenicity of this polymorphism is unclear.[provided by RefSeq, Mar 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)