STAT4 (NM_003151) Human Tagged ORF Clone

CAT#: RC206892

Reviews ()
Write a review

STAT4 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 4 (STAT4)



Reconstitution Protocol

USD 685.00

In Stock*

Size
    • 10 ug

Product images

Other products for "STAT4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol STAT4
Synonyms SLEB11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206892 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCAGTGGAATCAAGTCCAACAGTTAGAAATCAAGTTTTTGGAGCAGGTGGATCAATTCTATGATG
ACAACTTTCCCATGGAAATTCGGCATCTGTTGGCCCAATGGATTGAAAATCAAGACTGGGAGGCAGCTTC
TAACAATGAAACCATGGCAACGATTCTTCTTCAAAACTTGTTAATACAACTGGATGAACAGTTAGGTCGT
GTTTCCAAAGAGAAAAACCTACTCTTGATACACAATCTAAAAAGAATTAGGAAGGTCCTTCAGGGAAAAT
TTCATGGAAATCCAATGCATGTAGCTGTGGTTATTTCAAACTGTTTAAGGGAAGAGAGGAGAATATTGGC
TGCAGCCAACATGCCTGTCCAGGGGCCTCTAGAGAAATCCTTACAAAGTTCTTCAGTTTCAGAAAGACAG
AGGAATGTGGAGCACAAAGTGGCTGCCATTAAAAACAGTGTGCAGATGACAGAACAAGATACCAAATACT
TAGAAGATCTGCAAGACGAATTTGACTACAGGTATAAAACAATTCAGACAATGGATCAGAGTGACAAGAA
TAGTGCCATGGTGAATCAGGAAGTTTTGACACTGCAGGAAATGCTTAACAGCCTCGATTTCAAGAGAAAG
GAGGCTCTCAGTAAAATGACCCAAATCATCCATGAGACAGACCTGTTAATGAACACCATGCTCATAGAAG
AGCTGCAAGACTGGAAGCGGCGGCAGCAAATCGCCTGCATCGGGGGTCCACTCCACAATGGGCTCGACCA
GCTTCAGAACTGCTTTACACTATTGGCAGAAAGTCTTTTCCAACTGAGAAGGCAATTGGAGAAACTAGAG
GAGCAATCTACCAAAATGACATATGAAGGTGATCCCATTCCAATGCAAAGAACTCACATGCTAGAAAGAG
TCACCTTCTTGATCTACAACCTTTTCAAGAACTCATTTGTGGTTGAGCGACAGCCATGTATGCCAACCCA
CCCTCAGAGGCCGTTGGTACTTAAAACCCTAATTCAGTTCACTGTAAAACTAAGGCTACTAATAAAATTG
CCAGAACTAAACTATCAGGTAAAGGTTAAGGCATCAATTGACAAGAATGTTTCAACTCTAAGCAACCGAA
GATTTGTACTTTGTGGAACTAATGTCAAAGCCATGTCTATTGAAGAATCTTCCAATGGGAGTCTCTCAGT
AGAATTTCGACATTTGCAACCAAAGGAAATGAAGTCCAGTGCTGGAGGTAAAGGAAATGAGGGCTGTCAC
ATGGTGACTGAAGAACTTCATTCCATAACGTTTGAAACACAGATCTGCCTCTATGGCCTGACCATAGATT
TGGAGACCAGCTCATTGCCTGTGGTGATGATTTCCAATGTCAGTCAGTTACCTAATGCTTGGGCATCCAT
CATTTGGTACAACGTGTCAACCAACGATTCCCAGAACTTGGTTTTCTTTAATAATCCTCCACCTGCCACA
TTGAGTCAACTACTGGAGGTGATGAGCTGGCAGTTTTCATCGTACGTTGGTCGTGGTCTTAACTCAGATC
AACTCCATATGCTGGCAGAGAAGCTTACAGTCCAATCTAGCTACAGTGATGGTCACCTCACCTGGGCCAA
GTTCTGCAAGGAACATTTACCTGGTAAATCATTTACCTTTTGGACATGGCTTGAAGCAATATTGGATCTA
ATTAAGAAACACATTCTTCCCCTTTGGATTGATGGGTATGTCATGGGCTTTGTTAGCAAAGAGAAGGAAC
GGCTGTTGCTAAAGGATAAAATGCCTGGCACCTTTTTATTAAGATTCAGTGAAAGCCATCTCGGAGGAAT
AACTTTCACCTGGGTGGACCATTCTGAAAGTGGGGAAGTGAGATTCCACTCTGTAGAACCCTACAATAAA
GGCCGGTTGTCTGCTCTGCCATTCGCTGACATCCTGCGAGACTACAAAGTTATTATGGCTGAAAACATTC
CTGAAAACCCTCTGAAGTACCTATATCCTGACATTCCCAAAGACAAAGCCTTCGGTAAACACTACAGCTC
TCAGCCTTGCGAAGTTTCAAGACCAACAGAAAGGGGTGACAAAGGTTATGTTCCTTCTGTTTTTATCCCC
ATCTCAACAATCCGAAGTGATTCAACAGAGCCACATTCTCCATCAGACCTTCTTCCCATGTCTCCAAGTG
TGTATGCGGTGTTGAGAGAAAACCTGAGTCCCACAACAATTGAAACTGCAATGAAGTCTCCTTATTCTGC
TGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206892 protein sequence
Red=Cloning site Green=Tags(s)

MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGR
VSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQ
RNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRK
EALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLE
EQSTKMTYEGDPIPMQRTHMLERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKL
PELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPAT
LSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDL
IKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNK
GRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIP
ISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003151
ORF Size 2244 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003151.4
RefSeq Size 2840 bp
RefSeq ORF 2247 bp
Locus ID 6775
UniProt ID Q14765
Cytogenetics 2q32.2-q32.3
Domains SH2, STAT
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Jak-STAT signaling pathway
MW 85.9 kDa
Gene Summary The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells. Mutations in this gene may be associated with systemic lupus erythematosus and rheumatoid arthritis. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.