HHIP (NM_022475) Human Tagged ORF Clone

CAT#: RC206868

HHIP (Myc-DDK-tagged)-Human hedgehog interacting protein (HHIP)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HHIP (NM_022475) Human Tagged ORF Clone
Symbol HHIP
Synonyms HIP
Vector pCMV6-Entry
Sequence Data
>RC206868 representing NM_022475
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGAAGATGCTCTCCTTTAAGCTGCTGCTGCTGGCCGTGGCTCTGGGCTTCTTTGAAGGAGATGCTA
AGTTTGGGGAAAGAAACGAAGGGAGCGGAGCAAGGAGGAGAAGGTGCCTGAATGGGAACCCCCCGAAGCG
CCTGAAAAGGAGAGACAGGAGGATGATGTCCCAGCTGGAGCTGCTGAGTGGGGGAGAGATGCTGTGCGGT
GGCTTCTACCCTCGGCTGTCCTGCTGCCTGCGGAGTGACAGCCCGGGGCTAGGGCGCCTGGAGAATAAGA
TATTTTCTGTTACCAACAACACAGAATGTGGGAAGTTACTGGAGGAAATCAAATGTGCACTTTGCTCTCC
ACATTCTCAAAGCCTGTTCCACTCACCTGAGAGAGAAGTCTTGGAAAGAGACCTAGTACTTCCTCTGCTC
TGCAAAGACTATTGCAAAGAATTCTTTTACACTTGCCGAGGCCATATTCCAGGTTTCCTTCAAACAACTG
CGGATGAGTTTTGCTTTTACTATGCAAGAAAAGATGGTGGGTTGTGCTTTCCAGATTTTCCAAGAAAACA
AGTCAGAGGACCAGCATCTAACTACTTGGACCAGATGGAAGAATATGACAAAGTGGAAGAGATCAGCAGA
AAGCACAAACACAACTGCTTCTGTATTCAGGAGGTTGTGAGTGGGCTGCGGCAGCCCGTTGGTGCCCTGC
ATAGTGGGGATGGCTCGCAACGTCTCTTCATTCTGGAAAAAGAAGGTTATGTGAAGATACTTACCCCTGA
AGGAGAAATTTTCAAGGAGCCTTATTTGGACATTCACAAACTTGTTCAAAGTGGAATAAAGGGAGGAGAT
GAAAGAGGACTGCTAAGCCTCGCATTCCATCCCAATTACAAGAAAAATGGAAAGTTGTATGTGTCCTATA
CCACCAACCAAGAACGGTGGGCTATCGGGCCTCATGACCACATTCTTAGGGTTGTGGAATACACAGTATC
CAGAAAAAATCCACACCAAGTTGATTTGAGAACAGCCAGAGTCTTTCTTGAAGTTGCAGAACTCCACAGA
AAGCATCTGGGAGGACAACTGCTCTTTGGCCCTGACGGCTTTTTGTACATCATTCTTGGTGATGGGATGA
TTACACTGGATGATATGGAAGAAATGGATGGGTTAAGTGATTTCACAGGCTCAGTGCTACGGCTGGATGT
GGACACAGACATGTGCAACGTGCCTTATTCCATACCAAGGAGCAACCCACACTTCAACAGCACCAACCAG
CCCCCCGAAGTGTTTGCTCATGGGCTCCACGATCCAGGCAGATGTGCTGTGGATAGACATCCCACTGATA
TAAACATCAATTTAACGATACTGTGTTCAGACTCCAATGGAAAAAACAGATCATCAGCCAGAATTCTACA
GATAATAAAGGGGAAAGATTATGAAAGTGAGCCATCACTTTTAGAATTCAAGCCATTCAGTAATGGTCCT
TTGGTTGGTGGATTTGTATACCGGGGCTGCCAGTCAGAAAGATTGTATGGAAGCTACGTGTTTGGAGATC
GTAATGGGAATTTCCTAACTCTCCAGCAAAGTCCTGTGACAAAGCAGTGGCAAGAAAAACCACTCTGTCT
CGGCACTAGTGGGTCCTGTAGAGGCTACTTTTCCGGTCACATCTTGGGATTTGGAGAAGATGAACTAGGT
GAAGTTTACATTTTATCAAGCAGTAAAAGTATGACCCAGACTCACAATGGAAAACTCTACAAAATTGTAG
ATCCCAAAAGACCTTTAATGCCTGAGGAATGCAGAGCCACGGTACAACCTGCACAGACACTGACTTCAGA
GTGCTCCAGGCTCTGTCGAAACGGCTACTGCACCCCCACGGGAAAGTGCTGCTGCAGTCCAGGCTGGGAG
GGGGACTTCTGCAGAACTGCAAAATGTGAGCCAGCATGTCGTCATGGAGGTGTCTGTGTTAGACCGAACA
AGTGCCTCTGTAAAAAAGGATATCTTGGTCCTCAATGTGAACAAGTGGACAGAAACATCCGCAGAGTGAC
CAGGGCAGGTATTCTTGATCAGATCATTGACATGACATCTTACTTGCTGGATCTAACAAGTTACATTGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206868 representing NM_022475
Red=Cloning site Green=Tags(s)

MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCG
GFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLL
CKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISR
KHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGD
ERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHR
KHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGP
LVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELG
EVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWE
GDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022475
ORF Size 2100 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022475.1, NM_022475.2, NP_071920
RefSeq Size 3530
RefSeq ORF 2103
Locus ID 64399
Cytogenetics 4q31.21
Domains EGF
Protein Families Secreted Protein
Protein Pathways Hedgehog signaling pathway, Pathways in cancer, Basal cell carcinoma
MW 78.7 kDa
Gene Summary This gene encodes a member of the hedgehog-interacting protein (HHIP) family. The hedgehog (HH) proteins are evolutionarily conserved protein, which are important morphogens for a wide range of developmental processes, including anteroposterior patterns of limbs and regulation of left-right asymmetry in embryonic development. Multiple cell-surface receptors are responsible for transducing and/or regulating HH signals. The HHIP encoded by this gene is a highly conserved, vertebrate-specific inhibitor of HH signaling. It interacts with all three HH family members, SHH, IHH and DHH. Two single nucleotide polymorphisms (SNPs) near this gene are significantly associated with risk of chronic obstructive pulmonary disease (COPD). A single nucleotide polymorphism in this gene is also strongly associated with human height.[provided by RefSeq, Feb 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)