TMED2 (NM_006815) Human Tagged ORF Clone

  • Product Brand Image
SKU
RC206849
TMED2 (Myc-DDK-tagged)-Human transmembrane emp24 domain trafficking protein 2 (TMED2)
  $300.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMED2
Synonyms p24; P24A; p24b1; p24beta1; RNP24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206849 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGACGCTTGCTGAACTGCTGGTGCTCCTGGCCGCTCTCCTGGCCACGGTCTCGGGCTATTTCGTTA
GCATCGACGCCCATGCTGAAGAGTGCTTCTTTGAGCGGGTCACCTCGGGCACCAAGATGGGCCTCATCTT
CGAGGTGGCGGAGGGCGGCTTCCTGGACATCGACGTGGAGATTACAGGACCAGATAACAAAGGAATTTAC
AAAGGAGACAGAGAATCCAGTGGGAAATACACATTTGCTGCTCACATGGATGGAACATACAAATTTTGTT
TTAGTAACCGGATGTCCACCATGACTCCAAAAATAGTGATGTTCACCATTGATATTGGGGAGGCTCCAAA
AGGACAAGATATGGAAACAGAAGCTCACCAGAACAAGCTAGAAGAAATGATCAATGAGCTAGCAGTGGCG
ATGACAGCTGTAAAGCACGAACAGGAATACATGGAAGTCCGGGAGAGAATACACAGAGCCATCAACGACA
ACACAAACAGCAGAGTGGTCCTTTGGTCCTTCTTTGAAGCTCTTGTTCTAGTTGCCATGACATTGGGACA
GATCTACTACCTGAAGAGATTTTTTGAAGTCCGGAGAGTTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206849 protein sequence
Red=Cloning site Green=Tags(s)

MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIY
KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVA
MTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006815
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006815.2, NP_006806.1
RefSeq Size 2126 bp
RefSeq ORF 606 bp
Locus ID 10959
UniProt ID Q15363
Cytogenetics 12q24.31
Domains EMP24_GP25L
Protein Families Transmembrane
MW 22.8 kDa
Summary Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway but also in post-Golgi membranes. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act together with TMED10 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport inhibits the GTPase-activating activity of ARFGAP1 towards ARF1 thus preventing immature uncoating and allowing cargo selection to take place. Involved in trafficking of G protein-coupled receptors (GPCRs). Regulates F2RL1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Facilitates CASR maturation and stabilization in the early secretory pathway and increases CASR plasma membrane targeting. Proposed to be involved in organization of intracellular membranes such as the maintenance of the Golgi apparatus. May also play a role in the biosynthesis of secreted cargo such as eventual processing.[UniProtKB/Swiss-Prot Function]
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_006815" in other vectors (4)
SKU Description Size Price
RC206849L3 Lenti ORF clone of Human transmembrane emp24 domain trafficking protein 2 (TMED2), Myc-DDK-tagged 10 ug
$600.00
RC206849L4 Lenti ORF clone of Human transmembrane emp24 domain trafficking protein 2 (TMED2), mGFP tagged 10 ug
$600.00
RG206849 TMED2 (tGFP-tagged) - Human transmembrane emp24 domain trafficking protein 2 (TMED2) 10 ug
$489.00 $500.00
SC115869 TMED2 (untagged)-Human transmembrane emp24 domain trafficking protein 2 (TMED2) 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.