TMED2 (NM_006815) Human Tagged ORF Clone
SKU
RC206849
TMED2 (Myc-DDK-tagged)-Human transmembrane emp24 domain trafficking protein 2 (TMED2)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | TMED2 |
Synonyms | p24; P24A; p24b1; p24beta1; RNP24 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC206849 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGACGCTTGCTGAACTGCTGGTGCTCCTGGCCGCTCTCCTGGCCACGGTCTCGGGCTATTTCGTTA GCATCGACGCCCATGCTGAAGAGTGCTTCTTTGAGCGGGTCACCTCGGGCACCAAGATGGGCCTCATCTT CGAGGTGGCGGAGGGCGGCTTCCTGGACATCGACGTGGAGATTACAGGACCAGATAACAAAGGAATTTAC AAAGGAGACAGAGAATCCAGTGGGAAATACACATTTGCTGCTCACATGGATGGAACATACAAATTTTGTT TTAGTAACCGGATGTCCACCATGACTCCAAAAATAGTGATGTTCACCATTGATATTGGGGAGGCTCCAAA AGGACAAGATATGGAAACAGAAGCTCACCAGAACAAGCTAGAAGAAATGATCAATGAGCTAGCAGTGGCG ATGACAGCTGTAAAGCACGAACAGGAATACATGGAAGTCCGGGAGAGAATACACAGAGCCATCAACGACA ACACAAACAGCAGAGTGGTCCTTTGGTCCTTCTTTGAAGCTCTTGTTCTAGTTGCCATGACATTGGGACA GATCTACTACCTGAAGAGATTTTTTGAAGTCCGGAGAGTTGTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206849 protein sequence
Red=Cloning site Green=Tags(s) MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIY KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVA MTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006815 |
ORF Size | 603 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_006815.2, NP_006806.1 |
RefSeq Size | 2126 bp |
RefSeq ORF | 606 bp |
Locus ID | 10959 |
UniProt ID | Q15363 |
Cytogenetics | 12q24.31 |
Domains | EMP24_GP25L |
Protein Families | Transmembrane |
MW | 22.8 kDa |
Summary | Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway but also in post-Golgi membranes. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side. In COPII vesicle-mediated anterograde transport involved in the transport of GPI-anchored proteins and proposed to act together with TMED10 as their cargo receptor; the function specifically implies SEC24C and SEC24D of the COPII vesicle coat and lipid raft-like microdomains of the ER. Recognizes GPI anchors structural remodeled in the ER by PGAP1 and MPPE1. In COPI vesicle-mediated retrograde transport inhibits the GTPase-activating activity of ARFGAP1 towards ARF1 thus preventing immature uncoating and allowing cargo selection to take place. Involved in trafficking of G protein-coupled receptors (GPCRs). Regulates F2RL1, OPRM1 and P2RY4 exocytic trafficking from the Golgi to the plasma membrane thus contributing to receptor resensitization. Facilitates CASR maturation and stabilization in the early secretory pathway and increases CASR plasma membrane targeting. Proposed to be involved in organization of intracellular membranes such as the maintenance of the Golgi apparatus. May also play a role in the biosynthesis of secreted cargo such as eventual processing.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC206849L3 | Lenti ORF clone of Human transmembrane emp24 domain trafficking protein 2 (TMED2), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC206849L4 | Lenti ORF clone of Human transmembrane emp24 domain trafficking protein 2 (TMED2), mGFP tagged | 10 ug |
$600.00
|
|
RG206849 | TMED2 (tGFP-tagged) - Human transmembrane emp24 domain trafficking protein 2 (TMED2) | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC115869 | TMED2 (untagged)-Human transmembrane emp24 domain trafficking protein 2 (TMED2) | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.