PAK4(PAK4) (NM_001014831) Human Tagged ORF Clone

CAT#: RC206847

PAK4 (Myc-DDK-tagged)-Human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PAK4(PAK4) (NM_001014831) Human Tagged ORF Clone
Symbol PAK4
Synonyms p21(CDKN1A)-activated kinase 4; p21-activated kinase 4; protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs; p21 protein (Cdc42/Rac)-activated kinase 4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206847 representing NM_001014831
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGGAAGAGGAAGAAGCGGGTGGAGATCTCCGCGCCGTCCAACTTCGAGCACCGCGTGCACACGG
GCTTCGACCAGCACGAGCAGAAGTTCACGGGGCTGCCCCGCCAGTGGCAGAGCCTGATCGAGGAGTCGGC
TCGCCGGCCCAAGCCCCTCGTCGACCCCGCCTGCATCACCTCCATCCAGCCCGGGGCCCCCAAGACCATC
GTGCGGGGCAGCAAAGGTGCCAAAGATGGGGCCCTCACGCTGCTGCTGGACGAGTTTGAGAACATGTCGG
TGACACGCTCCAACTCCCTGCGGAGAGACAGCCCGCCGCCGCCCGCCCGTGCCCGCCAGGAAAATGGGAT
GCCAGAGGAGCCGGCCACCACGGCCAGAGGGGGCCCAGGGAAGGCAGGCAGCCGAGGCCGGTTCGCCGGT
CACAGCGAGGCGGGTGGCGGCAGTGGTGACAGGCGACGGGCGGGGCCAGAGAAGAGGCCCAAGTCTTCCA
GGGAGGGCTCAGGGGGTCCCCAGGAGTCCTCCCGGGACAAACGCCCCCTCTCCGGGCCTGATGTCGGCAC
CCCCCAGCCTGCTGGTCTGGCCAGTGGGGCGAAACTGGCAGCTGGCCGGCCCTTTAACACCTACCCGAGG
GCTGACACGGACCACCCATCCCGGGGTGCCCAGGGGGAGCCTCATGACGTGGCCCCTAACGGGCCATCAG
CGGGGGGCCTGGCCATCCCCCAGTCCTCCTCCTCCTCCTCCCGGCCTCCCACCCGAGCCCGAGGTGCCCC
CAGCCCTGGAGTGCTGGGACCCCACGCCTCAGAGCCCCAGCTGGCCCCTCCAGCCTGCACCCCCGCCGCC
CCTGCTGTTCCTGGGCCCCCTGGCCCCCGCTCACCACAGCGGGAGCCACAGCGAGTATCCCATGAGCAGT
TCCGGGCTGCCCTGCAGCTGGTGGTGGACCCAGGCGACCCCCGCTCCTACCTGGACAACTTCATCAAGAT
TGGCGAGGGCTCCACGGGCATCGTGTGCATCGCCACCGTGCGCAGCTCGGGCAAGCTGGTGGCCGTCAAG
AAGATGGACCTGCGCAAGCAGCAGAGGCGCGAGCTGCTCTTCAACGAGGTGGTAATCATGAGGGACTACC
AGCACGAGAATGTGGTGGAGATGTACAACAGCTACCTGGTGGGGGACGAGCTCTGGGTGGTCATGGAGTT
CCTGGAAGGAGGCGCCCTCACCGACATCGTCACCCACACCAGGATGAACGAGGAGCAGATCGCGGCCGTG
TGCCTTGCAGTGCTGCAGGCCCTGTCGGTGCTCCACGCCCAGGGCGTCATCCACCGGGACATCAAGAGCG
ACTCGATCCTGCTGACCCATGATGGCAGGGTGAAGCTGTCAGACTTTGGGTTCTGCGCCCAGGTGAGCAA
GGAAGTGCCCCGAAGGAAGTCGCTGGTCGGCACGCCCTACTGGATGGCCCCAGAGCTCATCTCCCGCCTT
CCCTACGGGCCAGAGGTAGACATCTGGTCGCTGGGGATAATGGTGATTGAGATGGTGGACGGAGAGCCCC
CCTACTTCAACGAGCCACCCCTCAAAGCCATGAAGATGATTCGGGACAACCTGCCACCCCGACTGAAGAA
CCTGCACAAGGTGTCGCCATCCCTGAAGGGCTTCCTGGACCGCCTGCTGGTGCGAGACCCTGCCCAGCGG
GCCACGGCAGCCGAGCTGCTGAAGCACCCATTCCTGGCCAAGGCAGGGCCGCCTGCCAGCATCGTGCCCC
TCATGCGCCAGAACCGCACCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206847 representing NM_001014831
Red=Cloning site Green=Tags(s)

MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKTI
VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAG
HSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPR
ADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA
PAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK
KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRL
PYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQR
ATAAELLKHPFLAKAGPPASIVPLMRQNRTR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001014831
ORF Size 1773 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001014831.1, NM_001014831.2, NP_001014831
RefSeq Size 3064
Locus ID 10298
Cytogenetics 19q13.2
Protein Families Protein Kinase, Druggable Genome
Protein Pathways ErbB signaling pathway, Axon guidance, Focal adhesion, T cell receptor signaling pathway, Regulation of actin cytoskeleton, Renal cell carcinoma
MW 63.9 kDa
Gene Summary PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.