RC74 (INTS9) (NM_018250) Human Tagged ORF Clone

CAT#: RC206837

Reviews ()
Write a review

INTS9 (Myc-DDK-tagged)-Human integrator complex subunit 9 (INTS9), transcript variant 1



Reconstitution Protocol

USD 612.00

In Stock*

Size
    • 10 ug

Product images

Other products for "INTS9"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol INTS9
Synonyms CPSF2L; INT9; RC74
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206837 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTGTATTGCCTGTCAGGGCACCCAACCTTACCATGCAATGTGCTCAAATTCAAATCAACCACCA
TTATGTTGGACTGCGGACTGGACATGACTTCTACCCTCAATTTCCTTCCTTTGCCACTTGTTCAAAGTCC
CAGGCTGTCCAATCTTCCTGGCTGGTCCCTGAAGGATGGAAATGCTTTCTTGGACAAGGAGCTAAAGGAG
TGCTCGGGTCATGTATTTGTGGATTCTGTGCCGGAATTCTGTTTACCAGAGACGGAGCTAATAGATCTGT
CTACAGTAGATGTGATTCTCATCTCTAACTATCACTGTATGATGGCGCTGCCATACATCACCGAGCACAC
CGGCTTCACAGGCACAGTGTATGCCACGGAACCCACCGTCCAGATCGGCAGGCTTCTCATGGAAGAGCTG
GTGAATTTCATTGAAAGAGTGCCAAAGGCTCAGTCTGCCTCCTTGTGGAAGAATAAGGACATTCAGAGGC
TGTTACCTTCTCCTCTCAAGGATGCAGTGGAAGTCTCAACCTGGAGAAGATGCTATACAATGCAAGAGGT
GAACTCTGCCCTTAGTAAAATCCAGCTGGTGGGATATTCTCAGAAAATTGAGCTTTTTGGTGCGGTCCAG
GTGACTCCTCTGAGCTCTGGCTATGCCCTTGGGAGCTCCAACTGGATCATCCAGTCTCATTACGAGAAAG
TGTCTTATGTCTCTGGATCCTCCTTGCTTACCACACACCCCCAGCCCATGGACCAAGCTTCTCTCAAAAA
CAGCGATGTTCTTGTTCTGACAGGGCTTACCCAGATCCCCACTGCAAACCCAGATGGAATGGTGGGAGAG
TTCTGCAGCAACCTAGCTCTGACAGTCCGGAATGGAGGAAACGTGTTGGTTCCCTGCTACCCTTCTGGAG
TGATCTATGACCTCCTGGAGTGCCTATATCAGTACATCGACTCAGCCGGGCTTTCCAGCGTCCCCCTCTA
CTTCATCTCCCCTGTGGCCAACAGTTCACTGGAGTTTTCCCAGATCTTTGCTGAGTGGCTTTGTCACAAC
AAACAGAGTAAGGTGTATCTTCCAGAACCACCTTTTCCTCATGCAGAGCTCATTCAGACCAATAAGCTGA
AGCACTACCCCAGCATCCACGGAGACTTCAGCAACGACTTTAGACAGCCCTGTGTGGTGTTCACCGGGCA
CCCTTCCCTCCGCTTCGGGGACGTGGTCCACTTCATGGAGCTCTGGGGAAAATCTAGTCTCAATACCGTC
ATATTCACGGAACCAGACTTCTCCTACCTGGAAGCCCTGGCTCCTTACCAGCCGCTGGCCATGAAATGCA
TCTACTGCCCCATCGACACCCGGCTGAACTTCATCCAGGTGTCAAAGCTGCTTAAAGAAGTGCAGCCCCT
GCACGTGGTGTGTCCTGAGCAGTACACTCAGCCGCCCCCAGCCCAGTCCCACAGGATGGACCTCATGATC
GACTGCCAGCCCCCCGCCATGTCCTATCGGCGGGCTGAGGTTCTCGCCCTGCCCTTCAAACGTCGGTACG
AGAAGATCGAGATCATGCCAGAGCTCGCAGATTCACTGGTGCCCATGGAGATCAAGCCTGGCATCTCCTT
GGCAACTGTCTCGGCCGTGCTGCACACCAAAGATAACAAGCACTTGCTTCAGCCCCCTCCTCGGCCCGCC
CAGCCCACGAGCGGGAAGAAGAGAAAGCGGGTGAGCGATGACGTACCAGACTGCAAAGTCCTGAAGCCTT
TGTTGAGCGGTTCCATCCCTGTGGAGCAGTTCGTGCAGACCCTGGAGAAGCATGGCTTCAGTGATATTAA
GGTGGAGGACACAGCCAAGGGCCATATCGTCCTGCTCCAGGAGGCTGAGACGCTCATCCAGATTGAAGAA
GACTCGACCCATATCATCTGCGACAATGACGAGATGCTCAGAGTGCGACTGCGGGACCTTGTCCTCAAAT
TCTTACAGAAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206837 protein sequence
Red=Cloning site Green=Tags(s)

MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKE
CSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEEL
VNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQ
VTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGE
FCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHN
KQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTV
IFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMI
DCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPA
QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEE
DSTHIICDNDEMLRVRLRDLVLKFLQKF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018250
ORF Size 1974 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018250.4
RefSeq Size 2764 bp
RefSeq ORF 1977 bp
Locus ID 55756
UniProt ID Q9NV88
Cytogenetics 8p21.1
MW 73.8 kDa
Gene Summary This gene encodes a subunit of the Integrator complex. This protein complex binds the C-terminal domain of RNA polymerase II and likely plays a role in small nuclear RNA processing. The encoded protein has similarities to the subunits of the cleavage and polyadenylation specificity factor complex. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.