DUSP10 (NM_007207) Human Tagged ORF Clone

CAT#: RC206760

DUSP10 (Myc-DDK-tagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DUSP10 (NM_007207) Human Tagged ORF Clone
Symbol DUSP10
Synonyms MKP-5; MKP5
Vector pCMV6-Entry
Sequence Data
>RC206760 representing NM_007207
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCCGTCTCCTTTAGACGACAGGGTAGTAGTGGCACTATCTAGGCCCGTCCGACCTCAGGATCTCA
ACCTTTGTTTAGACTCTAGTTACCTTGGCTCTGCCAACCCAGGCAGTAACAGCCACCCTCCTGTCATCGC
CACCACCGTTGTGTCCCTCAAGGCTGCGAATCTGACGTATATGCCCTCATCCAGCGGCTCTGCCCGCTCG
CTGAATTGTGGATGCAGCAGTGCCAGCTGCTGCACTGTGGCAACCTACGACAAGGACAATCAGGCCCAAA
CCCAAGCCATTGCCGCTGGCACCACCACCACTGCCATCGGAACCTCTACCACCTGCCCTGCTAACCAGAT
GGTCAACAATAATGAGAATACAGGCTCTCTAAGTCCATCAAGTGGGGTGGGCAGCCCTGTGTCAGGGACC
CCCAAGCAGCTAGCCAGCATCAAAATAATCTACCCCAATGACTTGGCAAAGAAGATGACCAAATGCAGCA
AGAGTCACCTGCCGAGTCAGGGCCCTGTCATCATTGACTGCAGGCCCTTCATGGAGTACAACAAGAGTCA
CATCCAAGGAGCTGTCCACATTAACTGTGCCGATAAGATCAGCCGGCGGAGACTGCAGCAGGGCAAGATC
ACTGTCCTAGACTTGATTTCCTGTAGGGAAGGCAAGGACTCTTTCAAGAGGATCTTTTCCAAAGAAATTA
TAGTTTATGATGAGAATACCAATGAACCAAGCCGAGTGATGCCCTCCCAGCCACTTCACATAGTCCTCGA
GTCCCTGAAGAGAGAAGGCAAAGAACCTCTGGTGTTGAAAGGTGGACTTAGTAGTTTTAAGCAGAACCAT
GAAAACCTCTGTGACAACTCCCTCCAGCTCCAAGAGTGCCGGGAGGTGGGGGGCGGCGCATCCGCGGCCT
CGAGCTTGCTACCTCAGCCCATCCCCACCACCCCTGACATCGAGAACGCTGAGCTCACCCCCATCTTGCC
CTTCCTGTTCCTTGGCAATGAGCAGGATGCTCAGGACCTGGACACCATGCAGCGGCTGAACATCGGCTAC
GTCATCAACGTCACCACTCATCTTCCCCTCTACCACTATGAGAAAGGCCTGTTCAACTACAAGCGGCTGC
CAGCCACTGACAGCAACAAGCAGAACCTGCGGCAGTACTTTGAAGAGGCTTTTGAGTTCATTGAGGAAGC
TCACCAGTGTGGGAAGGGGCTTCTCATCCACTGCCAGGCTGGGGTGTCCCGCTCCGCCACCATCGTCATC
GCTTACTTGATGAAGCACACTCGGATGACCATGACTGATGCTTATAAATTTGTCAAAGGCAAACGACCAA
TTATCTCCCCAAACCTTAACTTCATGGGGCAGTTGCTAGAGTTCGAGGAAGACCTAAACAACGGTGTGAC
ACCGAGAATCCTTACACCAAAGCTGATGGGCGTGGAGACGGTTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206760 representing NM_007207
Red=Cloning site Green=Tags(s)

MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARS
LNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGT
PKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKI
TVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNH
ENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGY
VINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007207
ORF Size 1446 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007207.2, NM_007207.3, NM_007207.4, NM_007207.5, NP_009138
RefSeq Size 2619
RefSeq ORF 1449
Locus ID 11221
Cytogenetics 1q41
Domains DSPc, RHOD
Protein Families Phosphatase, Druggable Genome
Protein Pathways MAPK signaling pathway
MW 52.5 kDa
Gene Summary Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAP kinase superfamily, which is associated with cellular proliferation and differentiation. Different members of this family of dual specificity phosphatases show distinct substrate specificities for MAP kinases, different tissue distribution and subcellular localization, and different modes of expression induction by extracellular stimuli. This gene product binds to and inactivates p38 and SAPK/JNK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)