Plzf(ZBTB16) (NM_006006) Human Tagged ORF Clone

CAT#: RC206745

ZBTB16 (Myc-DDK-tagged)-Human zinc finger and BTB domain containing 16 (ZBTB16), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Plzf(ZBTB16) (NM_006006) Human Tagged ORF Clone
Symbol ZBTB16
Synonyms PLZF; ZNF145
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206745 representing NM_006006
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTGACAAAAATGGGCATGATCCAGCTGCAGAACCCTAGCCACCCCACGGGGCTACTGTGCAAGG
CCAACCAGATGCGGCTGGCCGGGACTTTGTGCGATGTGGTCATCATGGTGGACAGCCAGGAGTTCCACGC
CCACCGGACGGTGCTGGCCTGCACCAGCAAGATGTTTGAGATCCTCTTCCACCGCAATAGTCAACACTAT
ACTTTGGACTTCCTCTCGCCAAAGACCTTCCAGCAGATTCTGGAGTATGCATATACAGCCACGCTGCAAG
CCAAGGCGGAGGACCTGGATGACCTGCTGTATGCGGCCGAGATCCTGGAGATCGAGTACCTGGAGGAACA
GTGCCTGAAGATGCTGGAGACCATCCAGGCCTCAGACGACAATGACACGGAGGCCACCATGGCCGATGGC
GGGGCCGAGGAAGAAGAGGACCGCAAGGCTCGGTACCTCAAGAACATCTTCATCTCGAAGCATTCCAGCG
AGGAGAGTGGGTATGCCAGTGTGGCTGGACAGAGCCTCCCTGGGCCCATGGTGGACCAGAGCCCTTCAGT
CTCCACTTCATTTGGTCTTTCAGCCATGAGTCCCACCAAGGCTGCAGTGGACAGTTTGATGACCATAGGA
CAGTCTCTCCTGCAGGGAACTCTTCAGCCACCTGCAGGGCCCGAGGAGCCAACTCTGGCTGGGGGTGGGC
GGCACCCTGGGGTGGCTGAGGTGAAGACGGAGATGATGCAGGTGGATGAGGTGCCCAGCCAGGACAGCCC
TGGGGCAGCCGAGTCCAGCATCTCAGGAGGGATGGGGGACAAGGTTGAGGAAAGAGGCAAAGAGGGGCCT
GGGACCCCGACTCGAAGCAGCGTCATCACCAGTGCTAGGGAGCTACACTATGGGCGAGAGGAGAGTGCCG
AGCAGGTGCCACCCCCAGCTGAGGCTGGCCAGGCCCCCACTGGCCGACCTGAGCACCCAGCACCCCCGCC
TGAGAAGCATCTGGGCATCTACTCCGTGTTGCCCAACCACAAGGCTGACGCTGTATTGAGCATGCCGTCT
TCCGTGACCTCTGGCCTCCACGTGCAGCCTGCCCTGGCTGTCTCCATGGACTTCAGCACCTATGGGGGGC
TGCTGCCCCAGGGCTTCATCCAGAGGGAGCTGTTCAGCAAGCTGGGGGAGCTGGCTGTGGGCATGAAGTC
AGAGAGCCGGACCATCGGAGAGCAGTGCAGCGTGTGTGGGGTCGAGCTTCCTGATAACGAGGCTGTGGAG
CAGCACAGGAAGCTGCACAGTGGGATGAAGACGTACGGGTGCGAGCTCTGCGGGAAGCGGTTCCTGGATA
GTTTGCGGCTGAGAATGCACTTACTGGCTCATTCAGCGGGTGCCAAAGCCTTTGTCTGTGATCAGTGCGG
TGCACAGTTTTCGAAGGAGGATGCCCTGGAGACACACAGGCAGACCCATACTGGCACTGACATGGCCGTC
TTCTGTCTGCTGTGTGGGAAGCGCTTCCAGGCGCAGAGCGCACTGCAGCAGCACATGGAGGTCCACGCGG
GCGTGCGCAGCTACATCTGCAGTGAGTGCAACCGCACCTTCCCCAGCCACACGGCTCTCAAACGCCACCT
GCGCTCACATACAGGCGACCACCCCTACGAGTGTGAGTTCTGTGGCAGCTGCTTCCGGGATGAGAGCACA
CTCAAGAGCCACAAACGCATCCACACGGGTGAGAAACCCTACGAGTGCAATGGCTGTGGCAAGAAGTTCA
GCCTCAAGCATCAGCTGGAGACGCACTATAGGGTGCACACAGGTGAGAAGCCCTTTGAGTGTAAGCTCTG
CCACCAGCGCTCCCGGGACTACTCGGCCATGATCAAGCACCTGAGAACGCACAACGGCGCCTCGCCCTAC
CAGTGCACCATCTGCACAGAGTACTGCCCCAGCCTCTCCTCCATGCAGAAGCACATGAAGGGCCACAAGC
CCGAGGAGATCCCGCCCGACTGGAGGATAGAGAAGACGTACCTCTACCTGTGCTATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206745 representing NM_006006
Red=Cloning site Green=Tags(s)

MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHY
TLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADG
GAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIG
QSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGP
GTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPS
SVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAV
FCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDEST
LKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPY
QCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006006
ORF Size 2019 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006006.1, NM_006006.2, NM_006006.3, NM_006006.4, NP_005997
RefSeq Size 2417
RefSeq ORF 2022
Locus ID 7704
Cytogenetics 11q23.2
Domains BTB, zf-C2H2
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Pathways in cancer, Acute myeloid leukemia
MW 74.1 kDa
Gene Summary This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations