NONO (NM_007363) Human Tagged ORF Clone

CAT#: RC206688

Reviews ()
Write a review

NONO (Myc-DDK-tagged)-Human non-POU domain containing, octamer-binding (NONO), transcript variant 2



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NONO"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NONO
Synonyms MRXS34; NMT55; NRB54; P54; P54NRB; PPP1R114
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206688 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAGTAATAAAACTTTTAACTTGGAGAAGCAAAACCATACTCCAAGAAAGCATCATCAACATCACC
ACCAGCAGCAGCACCACCAGCAGCAACAGCAGCAGCCGCCACCACCGCCAATACCTGCAAATGGGCAACA
GGCCAGCAGCCAAAATGAAGGCTTGACTATTGACCTGAAGAATTTTAGAAAACCAGGAGAGAAGACCTTC
ACCCAACGAAGCCGTCTTTTTGTGGGAAATCTTCCTCCCGACATCACTGAGGAAGAAATGAGGAAACTAT
TTGAGAAATATGGAAAGGCAGGCGAAGTCTTCATTCATAAGGATAAAGGATTTGGCTTTATCCGCTTGGA
AACCCGAACCCTAGCGGAGATTGCCAAAGTGGAGCTGGACAATATGCCACTCCGTGGAAAGCAGCTGCGT
GTGCGCTTTGCCTGCCATAGTGCATCCCTTACAGTTCGAAACCTTCCTCAGTATGTGTCCAACGAACTGC
TGGAAGAAGCCTTTTCTGTGTTTGGCCAGGTAGAGAGGGCTGTAGTCATTGTGGATGATCGAGGAAGGCC
CTCAGGAAAAGGCATTGTTGAGTTCTCAGGGAAGCCAGCTGCTCGGAAAGCTCTGGACAGATGCAGTGAA
GGCTCCTTCCTGCTAACCACATTTCCTCGTCCTGTGACTGTGGAGCCCATGGACCAGTTAGATGATGAAG
AGGGACTTCCAGAGAAGCTGGTTATAAAAAACCAGCAATTTCACAAGGAACGAGAGCAGCCACCCAGATT
TGCACAGCCTGGCTCCTTTGAGTATGAATATGCCATGCGCTGGAAGGCACTCATTGAGATGGAGAAGCAG
CAGCAGGACCAAGTGGACCGCAACATCAAGGAGGCTCGTGAGAAGCTGGAGATGGAGATGGAAGCTGCAC
GCCATGAGCACCAGGTCATGCTAATGAGACAGGATTTGATGAGGCGCCAAGAAGAACTTCGGAGGATGGA
AGAGCTGCACAACCAAGAGGTGCAAAAACGAAAGCAACTGGAGCTCAGGCAGGAGGAAGAGCGCAGGCGC
CGTGAAGAAGAGATGCGGCGGCAGCAAGAAGAAATGATGCGGCGACAGCAGGAAGGATTCAAGGGAACCT
TCCCTGATGCGAGAGAGCAGGAGATTCGGATGGGTCAGATGGCTATGGGAGGTGCTATGGGCATAAACAA
CAGAGGTGCCATGCCCCCTGCTCCTGTGCCAGCTGGTACCCCAGCTCCTCCAGGACCTGCCACTATGATG
CCGGATGGAACTTTGGGATTGACCCCACCAACAACTGAACGCTTTGGTCAGGCTGCTACAATGGAAGGAA
TTGGGGCAATTGGTGGAACTCCTCCTGCATTCAACCGTGCAGCTCCTGGAGCTGAATTTGCCCCAAACAA
ACGTCGCCGATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206688 protein sequence
Red=Cloning site Green=Tags(s)

MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF
TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR
VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ
QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR
REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007363
ORF Size 1413 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007363.5
RefSeq Size 3114 bp
RefSeq ORF 1416 bp
Locus ID 4841
UniProt ID Q15233
Cytogenetics Xq13.1
Domains RRM
Protein Families Druggable Genome, Transcription Factors
MW 54.2 kDa
Gene Summary This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. [provided by RefSeq, Feb 2009]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.