Adenosine A2b Receptor (ADORA2B) (NM_000676) Human Tagged ORF Clone

SKU
RC206623
ADORA2B (Myc-DDK-tagged)-Human adenosine A2b receptor (ADORA2B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Adenosine A2b Receptor
Synonyms ADORA2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206623 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTGGAGACACAGGACGCGCTGTACGTGGCGCTGGAGCTGGTCATCGCCGCGCTTTCGGTGGCGG
GCAACGTGCTGGTGTGCGCCGCGGTGGGCACGGCGAACACTCTGCAGACGCCCACCAACTACTTCCTGGT
GTCCCTGGCTGCGGCCGACGTGGCCGTGGGGCTCTTCGCCATCCCCTTTGCCATCACCATCAGCCTGGGC
TTCTGCACTGACTTCTACGGCTGCCTCTTCCTCGCCTGCTTCGTGCTGGTGCTCACGCAGAGCTCCATCT
TCAGCCTTCTGGCCGTGGCAGTCGACAGATACCTGGCCATCTGTGTCCCGCTCAGGTATAAAAGTTTGGT
CACGGGGACCCGAGCAAGAGGGGTCATTGCTGTCCTCTGGGTCCTTGCCTTTGGCATCGGATTGACTCCA
TTCCTGGGGTGGAACAGTAAAGACAGTGCCACCAACAACTGCACAGAACCCTGGGATGGAACCACGAATG
AAAGCTGCTGCCTTGTGAAGTGTCTCTTTGAGAATGTGGTCCCCATGAGCTACATGGTATATTTCAATTT
CTTTGGGTGTGTTCTGCCCCCACTGCTTATAATGCTGGTGATCTACATTAAGATCTTCCTGGTGGCCTGC
AGGCAGCTTCAGCGCACTGAGCTGATGGACCACTCGAGGACCACCCTCCAGCGGGAGATCCATGCAGCCA
AGTCACTGGCCATGATTGTGGGGATTTTTGCCCTGTGCTGGTTACCTGTGCATGCTGTTAACTGTGTCAC
TCTTTTCCAGCCAGCTCAGGGTAAAAATAAGCCCAAGTGGGCAATGAATATGGCCATTCTTCTGTCACAT
GCCAATTCAGTTGTCAATCCCATTGTCTATGCTTACCGGAACCGAGACTTCCGCTACACTTTTCACAAAA
TTATCTCCAGGTATCTTCTCTGCCAAGCAGATGTCAAGAGTGGGAATGGTCAGGCTGGGGTACAGCCTGC
TCTCGGTGTGGGCCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206623 protein sequence
Red=Cloning site Green=Tags(s)

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLG
FCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTP
FLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVAC
RQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSH
ANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000676
ORF Size 996 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000676.2, NP_000667.1
RefSeq Size 1885 bp
RefSeq ORF 999 bp
Locus ID 136
UniProt ID P29275
Cytogenetics 17p12
Domains 7tm_1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
MW 36.3 kDa
Summary This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Adenosine A2b Receptor (ADORA2B) (NM_000676) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206623L1 Lenti ORF clone of Human adenosine A2b receptor (ADORA2B), Myc-DDK-tagged 10 ug
$750.00
RC206623L2 Lenti ORF clone of Human adenosine A2b receptor (ADORA2B), mGFP tagged 10 ug
$750.00
RC206623L3 Lenti ORF clone of Human adenosine A2b receptor (ADORA2B), Myc-DDK-tagged 10 ug
$750.00
RC206623L4 Lenti ORF clone of Human adenosine A2b receptor (ADORA2B), mGFP tagged 10 ug
$750.00
RG206623 ADORA2B (tGFP-tagged) - Human adenosine A2b receptor (ADORA2B) 10 ug
$650.00
SC119758 ADORA2B (untagged)-Human adenosine A2b receptor (ADORA2B) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.