ALOX15 (NM_001140) Human Tagged ORF Clone

CAT#: RC206621

ALOX15 (Myc-DDK-tagged)-Human arachidonate 15-lipoxygenase (ALOX15)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_001140" in other vectors (7)

Reconstitution Protocol

USD 616.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
    • 100 ul

USD 478.00

Other products for "ALOX15"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ALOX15
Synonyms 12-LOX; 15-LOX; 15-LOX-1; LOG15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206621 representing NM_001140
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCTCTACCGCATCCGCGTGTCCACTGGGGCCTCGCTCTATGCCGGTTCCAACAACCAGGTGCAGC
TGTGGCTGGTCGGCCAGCACGGGGAGGCGGCGCTCGGGAAGCGACTGTGGCCCGCACGGGGCAAGGAGAC
AGAACTCAAGGTGGAAGTACCGGAGTATCTGGGGCCGCTGCTGTTTGTGAAACTGCGCAAACGGCACCTC
CTTAAGGACGACGCCTGGTTCTGCAACTGGATCTCTGTGCAGGGCCCCGGAGCCGGGGACGAGGTCAGGT
TCCCTTGTTACCGCTGGGTGGAGGGCAACGGCGTCCTGAGCCTGCCTGAAGGCACCGGCCGCACTGTGGG
CGAGGACCCTCAGGGCCTGTTCCAGAAACACCGGGAAGAAGAGCTGGAAGAGAGAAGGAAGTTGTACCGG
TGGGGAAACTGGAAGGACGGGTTAATTCTGAATATGGCTGGGGCCAAACTATATGACCTCCCTGTGGATG
AGCGATTTCTGGAAGACAAGAGAGTTGACTTTGAGGTTTCGCTGGCCAAGGGGCTGGCCGACCTCGCTAT
CAAAGACTCTCTAAATGTTCTGACTTGCTGGAAGGATCTAGATGACTTCAACCGGATTTTCTGGTGTGGT
CAGAGCAAGCTGGCTGAGCGCGTGCGGGACTCCTGGAAGGAAGATGCCTTATTTGGGTACCAGTTTCTTA
ATGGCGCCAACCCCGTGGTGCTGAGGCGCTCTGCTCACCTTCCTGCTCGCCTAGTGTTCCCTCCAGGCAT
GGAGGAACTGCAGGCCCAGCTGGAGAAGGAGCTGGAGGGAGGCACACTGTTCGAAGCTGACTTCTCCCTG
CTGGATGGGATCAAGGCCAACGTCATTCTCTGTAGCCAGCAGCACCTGGCTGCCCCTCTAGTCATGCTGA
AATTGCAGCCTGATGGGAAACTCTTGCCCATGGTCATCCAGCTCCAGCTGCCCCGCACAGGATCCCCACC
ACCTCCCCTTTTCTTGCCTACGGATCCCCCAATGGCCTGGCTTCTGGCCAAATGCTGGGTGCGCAGCTCT
GACTTCCAGCTCCATGAGCTGCAGTCTCATCTTCTGAGGGGACACTTGATGGCTGAGGTCATTGTTGTGG
CCACCATGAGGTGCCTGCCGTCGATACATCCTATCTTCAAGCTTATAATTCCCCACCTGCGATACACCCT
GGAAATTAACGTCCGGGCCAGGACTGGGCTGGTCTCTGACATGGGAATTTTCGACCAGATAATGAGCACT
GGTGGGGGAGGCCACGTGCAGCTGCTCAAGCAAGCTGGAGCCTTCCTAACCTACAGCTCCTTCTGTCCCC
CTGATGACTTGGCCGACCGGGGGCTCCTGGGAGTGAAGTCTTCCTTCTATCCCCAAGATGCGCTGCGGCT
CTGGGAAATCATCTATCGGTATGTGGAAGGAATCGTGAGTCTCCACTATAAGACAGACGTGGCTGTGAAA
GACGACCCAGAGCTGCAGACCTGGTGTCGAGAGATCACTGAAATCGGGCTGCAAGGGGCCCAGGACCGAG
GGTTTCCTGTCTCTTTACAGGCTCGGGACCAGGTTTGCCACTTTGTCACCATGTGTATCTTCACCTGCAC
CGGCCAACACGCCTCTGTGCACCTGGGCCAGCTGGACTGGTACTCTTGGGTGCCTAATGCACCCTGCACG
ATGCGGCTGCCCCCGCCAACCACCAAGGATGCAACGCTGGAGACAGTGATGGCGACACTGCCCAACTTCC
ACCAGGCTTCTCTCCAGATGTCCATCACTTGGCAGCTGGGCAGACGCCAGCCCGTTATGGTGGCTGTGGG
CCAGCATGAGGAGGAGTATTTTTCGGGCCCTGAGCCTAAGGCTGTGCTGAAGAAGTTCAGGGAGGAGCTG
GCTGCCCTGGATAAGGAAATTGAGATCCGGAATGCAAAGCTGGACATGCCCTACGAGTACCTGCGGCCCA
GCGTGGTGGAAAACAGTGTGGCCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206621 representing NM_001140
Red=Cloning site Green=Tags(s)

MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHL
LKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYR
WGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCG
QSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL
LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS
DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVK
DDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT
MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREEL
AALDKEIEIRNAKLDMPYEYLRPSVVENSVAI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001140
ORF Size 1986 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001140.2
RefSeq Size 2707 bp
RefSeq ORF 1989 bp
Locus ID 246
UniProt ID P16050
Cytogenetics 17p13.2
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways
MW 74.6 kDa
Gene Summary This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on various polyunsaturated fatty acid substrates to generate various bioactive lipid mediators such as eicosanoids, hepoxilins, lipoxins, and other molecules. The encoded enzyme and its reaction products have been shown to regulate inflammation and immunity. Multiple pseudogenes of this gene have been identified in the human genome. [provided by RefSeq, Aug 2017]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.