GCAP1(GUCA1A) (NM_000409) Human Tagged ORF Clone

CAT#: RC206595

GUCA1A (Myc-DDK-tagged)-Human guanylate cyclase activator 1A (retina) (GUCA1A)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name GCAP1(GUCA1A) (NM_000409) Human Tagged ORF Clone
Symbol GUCA1A
Synonyms C6orf131; COD3; CORD14; GCAP; GCAP1; GUCA; GUCA1
Vector pCMV6-Entry
Sequence Data
>RC206595 representing NM_000409
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAACGTGATGGAGGGAAAGTCAGTGGAGGAGCTGAGCAGCACCGAGTGCCACCAGTGGTACAAGA
AGTTCATGACTGAGTGCCCCTCTGGCCAACTCACCCTCTATGAGTTCCGCCAGTTCTTCGGCCTCAAGAA
CCTGAGCCCGTCGGCCAGCCAGTACGTGGAACAGATGTTTGAGACTTTTGACTTCAACAAGGACGGCTAC
ATTGATTTCATGGAGTACGTGGCAGCGCTCAGCTTGGTCCTCAAGGGGAAGGTGGAACAGAAGCTCCGCT
GGTACTTCAAGCTCTATGATGTAGATGGCAACGGCTGCATTGACCGCGATGAGCTGCTCACCATCATCCA
GGCCATTCGCGCCATTAACCCCTGCAGCGATACCACCATGACTGCAGAGGAGTTCACCGATACAGTGTTC
TCCAAGATTGACGTCAACGGGGATGGGGAACTCTCCCTGGAAGAGTTTATAGAGGGCGTCCAGAAGGACC
AGATGCTCCTGGACACACTGACACGAAGCCTGGACCTTACCCGCATCGTGCGCAGGCTCCAGAATGGCGA
GCAAGACGAGGAGGGGGCTGACGAGGCCGCTGAGGCAGCCGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206595 representing NM_000409
Red=Cloning site Green=Tags(s)

MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY
IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF
SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000409
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000409.1, NM_000409.2, NM_000409.3, NM_000409.4, NP_000400
RefSeq Size 1976
RefSeq ORF 606
Locus ID 2978
Cytogenetics 6p21.1
Domains EFh
Protein Families Druggable Genome
Protein Pathways Olfactory transduction
MW 22.7 kDa
Gene Summary This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)