SCNN1B (NM_000336) Human Tagged ORF Clone

CAT#: RC206580

Reviews ()
Write a review

SCNN1B (Myc-DDK-tagged)-Human sodium channel, nonvoltage-gated 1, beta (SCNN1B)



  "NM_000336" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SCNN1B
Synonyms BESC1; ENaCb; ENaCbeta; LIDLS1; SCNEB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206580 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACGTGAAGAAGTACCTGCTGAAGGGCCTGCATCGGCTGCAGAAGGGCCCCGGCTACACGTACAAGG
AGCTGCTGGTGTGGTACTGCGACAACACCAACACCCACGGCCCCAAGCGCACCATCTGTGAGGGGCCCAA
GAAGAAAGCCATGTGGTTCCTGCTCACCCTGCTCTTCGCCGCCCTCGTCTGCTGGCAGTGGGGCATCTTC
ATCAGGACCTACTTGAGCTGGGAGGTCAGCGTCTCCCTCTCCGTAGGCTTCAAGACCATGGACTTCCCTG
CCGTCACCATCTGCAATGCTAGCCCCTTCAAGTATTCCAAAATCAAGCATTTGCTGAAGGACCTGGATGA
GCTGATGGAAGCTGTCCTGGAGAGAATCCTGGCTCCTGAGCTAAGCCATGCCAATGCCACCAGGAACCTG
AACTTCTCCATCTGGAACCACACACCCCTGGTCCTTATTGATGAACGGAACCCCCACCACCCCATGGTCC
TTGATCTCTTTGGAGACAACCACAATGGCTTAACAAGCAGCTCAGCATCAGAAAAGATCTGTAATGCCCA
CGGGTGCAAAATGGCCATGAGACTATGTAGCCTCAACAGGACCCAGTGTACCTTCCGGAACTTCACCAGT
GCTACCCAGGCATTGACAGAGTGGTACATCCTGCAGGCCACCAACATCTTTGCACAGGTGCCACAGCAGG
AGCTAGTAGAGATGAGCTACCCCGGCGAGCAGATGATCCTGGCCTGCCTATTCGGAGCTGAGCCCTGCAA
CTACCGGAACTTCACGTCCATCTTCTACCCTCACTATGGCAACTGTTACATCTTCAACTGGGGCATGACA
GAGAAGGCACTTCCTTCGGCCAACCCTGGAACTGAATTCGGCCTGAAGTTGATCCTGGACATAGGCCAGG
AAGACTACGTCCCCTTCCTTGCGTCCACGGCCGGGGTCAGGCTGATGCTTCACGAGCAGAGGTCATACCC
CTTCATCAGAGATGAGGGCATCTACGCCATGTCGGGGACAGAGACGTCCATCGGGGTACTCGTGGACAAG
CTTCAGCGCATGGGGGAGCCCTACAGCCCGTGCACCGTGAATGGTTCTGAGGTCCCCGTCCAAAACTTCT
ACAGTGACTACAACACGACCTACTCCATCCAGGCCTGTCTTCGCTCCTGCTTCCAAGACCACATGATCCG
TAACTGCAACTGTGGCCACTACCTGTACCCACTGCCCCGTGGGGAGAAATACTGCAACAACCGGGACTTC
CCAGACTGGGCCCATTGCTACTCAGATCTACAGATGAGCGTGGCGCAGAGAGAGACCTGCATTGGCATGT
GCAAGGAGTCCTGCAATGACACCCAGTACAAGATGACCATCTCCATGGCTGACTGGCCTTCTGAGGCCTC
CGAGGACTGGATTTTCCACGTCTTGTCTCAGGAGCGGGACCAAAGCACCAATATCACCCTGAGCAGGAAG
GGAATTGTCAAGCTCAACATCTACTTCCAAGAATTTAACTATCGCACCATTGAAGAATCAGCAGCCAATA
ACATCGTCTGGCTGCTCTCGAATCTGGGTGGCCAGTTTGGCTTCTGGATGGGGGGCTCTGTGCTGTGCCT
CATCGAGTTTGGGGAGATCATCATCGACTTTGTGTGGATCACCATCATCAAGCTGGTGGCCTTGGCCAAG
AGCCTACGGCAGCGGCGAGCCCAAGCCAGCTACGCTGGCCCACCGCCCACCGTGGCCGAGCTGGTGGAGG
CCCACACCAACTTTGGCTTCCAGCCTGACACGGCCCCCCGCAGCCCCAACACTGGGCCCTACCCCAGTGA
GCAGGCCCTGCCCATCCCAGGCACCCCGCCCCCCAACTATGACTCCCTGCGTCTGCAGCCGCTGGACGTC
ATCGAGTCTGACAGTGAGGGTGATGCCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206580 protein sequence
Red=Cloning site Green=Tags(s)

MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIF
IRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNL
NFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTS
ATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMT
EKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDK
LQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRK
GIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAK
SLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDV
IESDSEGDAI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000336
ORF Size 1920 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000336.3
RefSeq Size 2597 bp
RefSeq ORF 1923 bp
Locus ID 6338
UniProt ID P51168
Cytogenetics 16p12.2
Domains ASC
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Protein Pathways Taste transduction
MW 72.6 kDa
Gene Summary Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome. [provided by RefSeq, Apr 2009]

Other Versions

Other products for "SCNN1B"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-SCNN1B Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.