COX6A2 (NM_005205) Human Tagged ORF Clone
CAT#: RC206539
COX6A2 (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_005205" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | COX6A2 |
Synonyms | COX6AH; COXVIAH; MC4DN18 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206539 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTTTGCCTCTGAGGCCCCTGACCCGGGGCTTGGCCAGCGCTGCCAAAGGAGGCCACGGAGGAGCAG GAGCTCGTACCTGGCGTCTGCTGACCTTCGTGCTGGCGCTGCCCAGCGTGGCCCTCTGCACCTTCAACTC CTATCTCCACTCGGGCCACCGCCCGCGCCCCGAGTTCCGTCCCTACCAACACCTCCGCATCCGCACCAAG CCCTACCCCTGGGGGGACGGCAACCACACTCTGTTCCACAATAGCCACGTGAACCCTCTGCCCACGGGCT ACGAACACCCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206539 protein sequence
Red=Cloning site Green=Tags(s) MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK PYPWGDGNHTLFHNSHVNPLPTGYEHP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005205 |
ORF Size | 291 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005205.4 |
RefSeq Size | 441 bp |
RefSeq ORF | 294 bp |
Locus ID | 1339 |
UniProt ID | Q02221 |
Cytogenetics | 16p11.2 |
Domains | COX6A |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
MW | 10.8 kDa |
Gene Summary | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206539L3 | Lenti ORF clone of Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
USD 450.00 |
|
RC206539L4 | Lenti ORF clone of Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein, mGFP tagged |
USD 450.00 |
|
RG206539 | COX6A2 (tGFP-tagged) - Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein |
USD 350.00 |
|
SC116905 | COX6A2 (untagged)-Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review