COX6A2 (NM_005205) Human Tagged ORF Clone

CAT#: RC206539

COX6A2 (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIa polypeptide 2 (COX6A2), nuclear gene encoding mitochondrial protein

Product Images

Circular map for RC206539

• 

  Western blot validation of overexpression lysate (Cat# LY417442) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC206539 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified COX6A2 protein (Cat# TP306539). The protein was produced from HEK293T cells transfected with COX6A2 cDNA clone (Cat# RC206539) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: COX6A2
• Synonyms: COX6AH; COXVIAH; MC4DN18
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC206539 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTTTGCCTCTGAGGCCCCTGACCCGGGGCTTGGCCAGCGCTGCCAAAGGAGGCCACGGAGGAGCAG
  GAGCTCGTACCTGGCGTCTGCTGACCTTCGTGCTGGCGCTGCCCAGCGTGGCCCTCTGCACCTTCAACTC
  CTATCTCCACTCGGGCCACCGCCCGCGCCCCGAGTTCCGTCCCTACCAACACCTCCGCATCCGCACCAAG
  CCCTACCCCTGGGGGGACGGCAACCACACTCTGTTCCACAATAGCCACGTGAACCCTCTGCCCACGGGCT
  ACGAACACCCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC206539 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK
  PYPWGDGNHTLFHNSHVNPLPTGYEHP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005205
• ORF Size: 291 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005205.4
• RefSeq Size: 441 bp
• RefSeq ORF: 294 bp
• Locus ID: 1339
• UniProt ID: Q02221
• Cytogenetics: 16p11.2
• Domains: COX6A
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
• MW: 10.8 kDa
• Gene Summary: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. [provided by RefSeq, Jul 2008]