RAB27B (NM_004163) Human Tagged ORF Clone

CAT#: RC206519

RAB27B (Myc-DDK-tagged)-Human RAB27B, member RAS oncogene family (RAB27B)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name RAB27B (NM_004163) Human Tagged ORF Clone
Symbol RAB27B
Synonyms C25KG; C25KG
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206519 representing NM_004163
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGATGGAGACTATGATTATCTGATCAAACTCCTGGCCCTCGGGGATTCAGGGGTGGGGAAGACAA
CATTTCTTTATAGATACACAGATAATAAATTCAATCCCAAATTCATCACTACAGTAGGAATAGACTTTCG
GGAAAAACGTGTGGTTTATAATGCACAAGGACCGAATGGATCTTCAGGGAAAGCATTTAAAGTGCATCTT
CAGCTTTGGGACACTGCGGGACAAGAGCGGTTCCGGAGTCTCACCACTGCATTTTTCAGAGACGCCATGG
GCTTCTTATTAATGTTTGACCTCACCAGTCAACAGAGCTTCTTAAATGTCAGAAACTGGATGAGCCAACT
GCAAGCAAATGCTTATTGTGAAAATCCAGATATAGTATTAATTGGCAACAAGGCAGACCTACCAGATCAG
AGGGAAGTCAATGAACGGCAAGCTCGGGAACTGGCTGACAAATATGGCATACCATATTTTGAAACAAGTG
CAGCAACTGGACAGAATGTGGAGAAAGCTGTAGAAACCCTTTTGGACTTAATCATGAAGCGAATGGAACA
GTGTGTGGAGAAGACACAAATCCCTGATACTGTCAATGGTGGAAATTCTGGAAACTTGGATGGGGAAAAG
CCACCAGAGAAGAAATGTATCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206519 representing NM_004163
Red=Cloning site Green=Tags(s)

MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHL
QLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ
REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEK
PPEKKCIC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004163
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004163.1, NM_004163.2, NM_004163.3, NM_004163.4, NP_004154
RefSeq Size 1365
RefSeq ORF 657
Locus ID 5874
Cytogenetics 18q21.2
Domains ras, RAN, RAS, RHO, RAB
Protein Families Druggable Genome
MW 24.4 kDa
Gene Summary Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)