CISH (NM_145071) Human Tagged ORF Clone

CAT#: RC206496

CISH (Myc-DDK-tagged)-Human cytokine inducible SH2-containing protein (CISH), transcript variant 2



  "NM_145071" in other vectors (6)

Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CISH"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CISH
Synonyms BACTS2; CIS; CIS-1; G18; SOCS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206496 representing NM_145071
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCTCTGCGTTCAGGGACCTCGTCCTTTGCTGGCTGTGGAGCGGACTGGGCAGCGGCCCCTGTGGG
CCCCGTCCCTGGAACTGCCCAAGCCAGTCATGCAGCCCTTGCCTGCTGGGGCCTTCCTCGAGGAGGTGGC
AGAGGGTACCCCAGCCCAGACAGAGAGTGAGCCAAAGGTGCTGGACCCAGAGGAGGATCTGCTGTGCATA
GCCAAGACCTTCTCCTACCTTCGGGAATCTGGCTGGTATTGGGGTTCCATTACGGCCAGCGAGGCCCGAC
AACACCTGCAGAAGATGCCAGAAGGCACGTTCTTAGTACGTGACAGCACGCACCCCAGCTACCTGTTCAC
GCTGTCAGTGAAAACCACTCGTGGCCCCACCAATGTACGCATTGAGTATGCTGACTCCAGCTTCCGTCTG
GACTCCAACTGCTTGTCCAGGCCACGCATCCTGGCCTTTCCGGATGTGGTCAGCCTTGTGCAGCACTATG
TGGCCTCCTGCACTGCTGATACCCGAAGCGACAGCCCCGATCCTGCTCCCACCCCGGCCCTGCCTATGCC
TAAGGAGGATGCGCCTAGTGACCCAGCACTGCCTGCTCCTCCACCAGCCACTGCTGTACACCTAAAACTG
GTGCAGCCCTTTGTACGCAGAAGCAGCGCCCGCAGCCTGCAACACCTGTGCCGCCTTGTCATCAACCGTC
TGGTGGCCGACGTGGACTGCCTGCCACTGCCCCGGCGCATGGCCGACTACCTCCGACAGTACCCCTTCCA
GCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206496 representing NM_145071
Red=Cloning site Green=Tags(s)

MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCI
AKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRL
DSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKL
VQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145071
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145071.4
RefSeq Size 2035 bp
RefSeq ORF 777 bp
Locus ID 1154
UniProt ID Q9NSE2
Cytogenetics 3p21.2
Domains SH2, SOCS
Protein Families Druggable Genome
Protein Pathways Jak-STAT signaling pathway
MW 28.5 kDa
Gene Summary The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.