CPNE7 (NM_153636) Human Tagged ORF Clone

CAT#: RC206428

CPNE7 (Myc-DDK-tagged)-Human copine VII (CPNE7), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name CPNE7 (NM_153636) Human Tagged ORF Clone
Symbol CPNE7
Synonyms MGC34192
Vector pCMV6-Entry
Sequence Data
>RC206428 representing NM_153636
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGCGGGCTCGGAGCGCGGGGCGGCGGCAACCCCCGGGGGTTTGCCCGCGCCCTGCGCCTCGAAGG
TGGAGCTGCGGCTCAGCTGCCGGCACCTGCTGGACCGCGACCCGCTCACCAAGTCCGACCCCAGCGTGGC
GTTGCTGCAGCAGGCGCAGGGCCAGTGGGTGCAGGTGGGCAGAACCGAGGTGGTCCGGAGCAGCCTGCAT
CCCGTGTTCTCCAAGGTCTTCACGGTGGACTACTACTTCGAGGAGGTGCAGAGGCTGCGCTTTGAGGTGT
ACGACACGCATGGGCCCAGCGGCTTCAGCTGTCAGGAGGACGATTTCCTGGGGGGCATGGAGTGCACCCT
GGGGCAGATTGTGGCCCAGAAGAAGGTGACCCGCCCGCTGCTGCTCAAGTTTGGCAGGAACGCTGGCAAG
TCCACCATCACGGTGATCGCCGAGGACATCTCGGGGAACAACGGCTACGTGGAGCTCTCCTTCCGGGCCA
GGAAGCTGGACGACAAGGACCTCTTCAGCAAGTCCGACCCCTTCCTGGAGCTCTACAGGGTCAACGACGA
CCAGGGCTTGCAGCTGGTGTACAGGACGGAGGTGGTGAAGAACAACCTGAACCCGGTGTGGGAGGCCTTC
AAAGTCTCTCTGAGTTCCCTCTGCAGCTGCGAGGAGACAAGGCCTCTAAAGTGCCTGGTCTGGGATTACG
ACTCTCGAGGAAAGCACGACTTCATCGGAGAATTCTCTACCACCTTCGAGGAGATGCAGAAGGCCTTTGA
GGAGGGGCAGGCCCAGTGGGACTGTGTGAACCCCAAATACAAGCAGAAGAGACGCAGTTATAAGAACTCA
GGAGTGGTCGTCCTGGCTGACCTCAAGTTCCACAGGGTGTACTCCTTCCTGGACTATATCATGGGCGGCT
GCCAGATCCACTTCACCGTGGCCATTGACTTCACCGCCTCCAATGGAGACCCGCGGAACAGCTGCTCCCT
GCACTACATCAACCCCTACCAGCCGAACGAGTACCTGAAGGCACTGGTGTCCGTGGGCGAGATCTGCCAG
GACTATGACAGTGACAAGAGGTTTTCCGCTTTGGGGTTTGGAGCCCGGATCCCTCCCAAGTATGAGGTGT
CCCATGACTTTGCCATCAATTTCAACCCTGAGGACGATGAGTGTGAAGGCATCCAGGGCGTGGTGGAGGC
CTACCAGAACTGCCTGCCCAGGGTCCAGCTCTACGGCCCCACCAACGTGGCGCCCATCATCTCCAAGGTG
GCACGCGTGGCGGCGGCCGAGGAGAGCACCGGGAAAGCCTCTCAATACTACATCCTGCTGATCCTGACGG
ACGGCGTGGTGACCGACATGGCCGACACACGGGAGGCCATTGTGCGTGCCTCACGCCTGCCCATGTCCAT
CATCATCGTGGGCGTGGGCAACGCCGACTTCACCGACATGCAGGTCCTGGACGGCGACGACGGCGTCCTG
CGCTCCCCACGGGGTGAGCCCGCGCTCCGGGACATCGTACAGTTCGTGCCCTTCCGGGAGCTCAAGAACG
CATCCCCTGCGGCGCTGGCCAAGTGCGTGCTGGCCGAGGTCCCGAAGCAGGTGGTGGAGTACTACAGCCA
CAGAGGCCTGCCCCCGAGAAGCCTGGGCGTCCCTGCCGGAGAGGCCAGCCCAGGCTGCACACCG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC206428 representing NM_153636
Red=Cloning site Green=Tags(s)

MSAGSERGAAATPGGLPAPCASKVELRLSCRHLLDRDPLTKSDPSVALLQQAQGQWVQVGRTEVVRSSLH
PVFSKVFTVDYYFEEVQRLRFEVYDTHGPSGFSCQEDDFLGGMECTLGQIVAQKKVTRPLLLKFGRNAGK
STITVIAEDISGNNGYVELSFRARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEAF
KVSLSSLCSCEETRPLKCLVWDYDSRGKHDFIGEFSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNS
GVVVLADLKFHRVYSFLDYIMGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKALVSVGEICQ
DYDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPRVQLYGPTNVAPIISKV
ARVAAAEESTGKASQYYILLILTDGVVTDMADTREAIVRASRLPMSIIIVGVGNADFTDMQVLDGDDGVL
RSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_153636
ORF Size 1674 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_153636.1, NM_153636.2, NP_705900
RefSeq Size 2470
RefSeq ORF 1677
Locus ID 27132
Cytogenetics 16q24.3
MW 61.8 kDa
Gene Summary This gene encodes a member of the copine family, which is composed of calcium-dependent membrane-binding proteins. The gene product contains two N-terminal C2 domains and one von Willebrand factor A domain. The encoded protein may be involved in membrane trafficking. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)