ALG1 (NM_019109) Human Tagged ORF Clone

CAT#: RC206343

ALG1 (Myc-DDK-tagged)-Human asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S. cerevisiae) (ALG1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ALG1 (NM_019109) Human Tagged ORF Clone
Symbol ALG1
Synonyms CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1
Vector pCMV6-Entry
Sequence Data
>RC206343 representing NM_019109
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCTCATGCTTGGTCCTGCTGGCGCTGTGTCTGCTGCTGCCGCTGCTGCTGCTGGGAGGATGGA
AGCGCTGGCGCCGGGGGCGGGCGGCCCGGCATGTAGTAGCGGTGGTGCTGGGCGACGTGGGCCGCAGCCC
CCGTATGCAGTACCACGCGCTGTCGTTGGCCATGCACGGCTTCTCGGTGACCCTCCTGGGGTTCTGCAAC
TCCAAACCCCATGATGAGCTCTTGCAGAACAACAGAATTCAGATTGTGGGGTTGACAGAACTTCAGAGTC
TTGCAGTTGGGCCCCGAGTTTTCCAGTACGGAGTCAAAGTTGTACTTCAGGCTATGTACTTGCTGTGGAA
GTTGATGTGGAGGGAGCCAGGTGCCTATATCTTTCTCCAGAACCCCCCAGGTCTGCCTAGCATTGCTGTC
TGCTGGTTCGTGGGCTGCCTTTGTGGAAGCAAGCTCGTCATTGACTGGCACAACTATGGCTACTCCATCA
TGGGTCTGGTGCATGGCCCCAACCATCCCCTCGTTCTGCTGGCCAAGTGGTACGAGAAGTTCTTTGGGCG
CCTGTCCCACCTGAACCTGTGTGTTACCAATGCTATGCGAGAAGACCTGGCGGATAACTGGCACATCAGG
GCTGTGACCGTCTACGACAAGCCCGCATCTTTCTTTAAAGAGACACCTCTGGACCTGCAGCACCGGCTCT
TCATGAAGCTGGGCAGCATGCACTCTCCGTTCAGGGCCCGCTCAGAACCTGAGGACCCAGTCACGGAGCG
GTCGGCCTTCACGGAGCGGGATGCTGGGAGCGGGCTGGTGACGCGTCTCCGTGAGCGGCCAGCCCTGCTG
GTCAGCAGCACGAGCTGGACAGAGGACGAAGACTTCTCCATCCTGCTGGCAGCTTTAGAAAAGTTTGAAC
AACTGACTCTTGATGGACACAACCTTCCTTCTCTCGTCTGTGTGATAACAGGCAAAGGGCCTATGAGGGA
GTATTATAGCCGCCTCATCCACCAGAAGCACTTCCAGCACATCCAGGTCTGCACCCCCTGGCTGGAGGCC
GAGGACTACCCCCTGCTTCTAGGGTCGGCGGACCTGGGTGTCTGTCTGCACACGTCCTCCAGTGGCCTGG
ACCTGCCCATGAAGGTGGTGGACATGTTCGGGTGCTGTTTGCCTGTGTGTGCTGTGAACTTCAAGTGTTT
ACATGAGCTGGTGAAACATGAAGAAAATGGCCTGGTCTTTGAGGACTCAGAGGAACTGGCAGCTCAGCTG
CAGATGCTTTTCTCAAACTTTCCTGATCCTGCGGGCAAGCTAAACCAGTTCCGGAAGAACCTGCGGGAGT
CGCAGCAGCTCCGATGGGATGAGAGCTGGGTGCGGACTGTGCTCCCTTTGGTTATGGACACA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC206343 representing NM_019109
Red=Cloning site Green=Tags(s)

MAASCLVLLALCLLLPLLLLGGWKRWRRGRAARHVVAVVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCN
SKPHDELLQNNRIQIVGLTELQSLAVGPRVFQYGVKVVLQAMYLLWKLMWREPGAYIFLQNPPGLPSIAV
CWFVGCLCGSKLVIDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIR
AVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERPALL
VSSTSWTEDEDFSILLAALEKFEQLTLDGHNLPSLVCVITGKGPMREYYSRLIHQKHFQHIQVCTPWLEA
EDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCCLPVCAVNFKCLHELVKHEENGLVFEDSEELAAQL
QMLFSNFPDPAGKLNQFRKNLRESQQLRWDESWVRTVLPLVMDT

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019109
ORF Size 1392 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019109.1, NM_019109.2, NM_019109.3, NM_019109.4, NP_061982
RefSeq Size 2149
RefSeq ORF 1395
Locus ID 56052
Cytogenetics 16p13.3
Protein Families Transmembrane
Protein Pathways N-Glycan biosynthesis, Metabolic pathways
MW 52.3 kDa
Gene Summary The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik. [provided by RefSeq, Dec 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)