Ceramide glucosyltransferase (UGCG) (NM_003358) Human Tagged ORF Clone

CAT#: RC206288

UGCG (Myc-DDK-tagged)-Human UDP-glucose ceramide glucosyltransferase (UGCG)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_003358" in other vectors (6)

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


UGCG rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "Ceramide glucosyltransferase"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Ceramide glucosyltransferase
Synonyms GCS; GLCT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206288 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGCTGGACCTGGCCTTGGAGGGAATGGCCGTCTTCGGGTTCGTCCTCTTCTTGGTGCTGTGGC
TGATGCATTTCATGGCTATCATCTACACCCGATTACACCTCAACAAGAAGGCAACTGACAAACAGCCTTA
TAGCAAGCTCCCAGGTGTCTCTCTTCTGAAACCACTGAAAGGGGTAGATCCTAACTTAATCAACAACCTG
GAAACATTCTTTGAATTGGATTATCCCAAATATGAAGTGCTCCTTTGTGTACAAGATCATGATGATCCAG
CCATTGATGTATGTAAGAAGCTTCTTGGAAAATATCCAAATGTTGATGCTAGATTGTTTATAGGTGGCAA
AAAAGTTGGCATTAATCCTAAAATTAATAATTTAATGCCAGGATATGAAGTTGCAAAGTATGATCTTATA
TGGATTTGTGATAGTGGAATAAGAGTAATTCCAGATACACTTACTGACATGGTGAATCAAATGACAGAAA
AAGTAGGCTTGGTTCACGGGCTGCCTTACGTAGCAGACAGACAGGGCTTTGCTGCCACCTTAGAGCAGGT
ATATTTTGGAACTTCACATCCAAGATACTATATCTCTGCCAATGTAACTGGTTTCAAATGTGTGACAGGA
ATGTCTTGTTTAATGAGAAAAGATGTGTTGGATCAAGCAGGAGGACTTATAGCTTTTGCTCAGTACATTG
CCGAAGATTACTTTATGGCCAAAGCGATAGCTGACCGAGGTTGGAGGTTTGCAATGTCCACTCAAGTTGC
AATGCAAAACTCTGGCTCATATTCAATTTCTCAGTTTCAATCCAGAATGATCAGGTGGACCAAACTACGA
ATTAACATGCTTCCTGCTACAATAATTTGTGAGCCAATTTCAGAATGCTTTGTTGCCAGTTTAATTATTG
GATGGGCAGCCCACCATGTGTTCAGATGGGATATTATGGTATTTTTCATGTGTCATTGCCTGGCATGGTT
TATATTTGACTACATTCAACTCAGGGGTGTCCAGGGTGGCACACTGTGTTTTTCAAAACTTGATTATGCA
GTCGCCTGGTTCATCCGCGAATCCATGACAATATACATTTTTTTGTCTGCATTATGGGACCCAACTATAA
GCTGGAGAACTGGTCGCTACAGATTACGCTGTGGGGGTACAGCAGAGGAAATCCTAGATGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206288 protein sequence
Red=Cloning site Green=Tags(s)

MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003358
ORF Size 1182 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003358.3
RefSeq Size 1637 bp
RefSeq ORF 1185 bp
Locus ID 7357
UniProt ID Q16739
Cytogenetics 9q31.3
Domains Glycos_transf_2
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
MW 44.9 kDa
Gene Summary This gene encodes an enzyme that catalyzes the first glycosylation step in the biosynthesis of glycosphingolipids, which are membrane components containing lipid and sugar moieties. The product of this reaction is glucosylceramide, which is the core structure of many glycosphingolipids. [provided by RefSeq, Dec 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.