TMEM106B (NM_018374) Human Tagged ORF Clone

CAT#: RC206257

1 star1 star1 star1 star1 star Reviews (1)

  • TrueORF®

TMEM106B (Myc-DDK-tagged)-Human transmembrane protein 106B (TMEM106B), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_018374" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 300.00

4 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal TMEM106B Antibody
    • 100 ug

USD 528.00

Other products for "TMEM106B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TMEM106B
Synonyms HLD16
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206257 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAAGTCTCTTTCTCATTTGCCTTTGCATTCAAGCAAAGAAGATGCTTATGATGGAGTCACATCTG
AAAACATGAGGAATGGACTGGTTAATAGTGAAGTCCATAATGAAGATGGAAGAAATGGAGATGTCTCTCA
GTTTCCATATGTGGAATTTACAGGAAGAGATAGTGTCACCTGCCCTACTTGTCAGGGAACAGGAAGAATT
CCTAGGGGGCAAGAAAACCAACTGGTGGCATTGATTCCATATAGTGATCAGAGATTAAGGCCAAGAAGAA
CAAAGCTGTATGTGATGGCTTCTGTGTTTGTCTGTCTACTCCTTTCTGGATTGGCTGTGTTTTTCCTTTT
CCCTCGCTCTATCGACGTGAAATACATTGGTGTAAAATCAGCCTATGTCAGTTATGATGTTCAGAAGCGT
ACAATTTATTTAAATATCACAAACACACTAAATATAACAAACAATAACTATTACTCTGTCGAAGTTGAAA
ACATCACTGCCCAAGTTCAATTTTCAAAAACAGTTATTGGAAAGGCACGCTTAAACAACATAACCATTAT
TGGTCCACTTGATATGAAACAAATTGATTACACAGTACCTACCGTTATAGCAGAGGAAATGAGTTATATG
TATGATTTCTGTACTCTGATATCCATCAAAGTGCATAACATAGTACTCATGATGCAAGTTACTGTGACAA
CAACATACTTTGGCCACTCTGAACAGATATCCCAGGAGAGGTATCAGTATGTCGACTGTGGAAGAAACAC
AACTTATCAGTTGGGGCAGTCTGAATATTTAAATGTACTTCAGCCACAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206257 protein sequence
Red=Cloning site Green=Tags(s)

MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRI
PRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDVQKR
TIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYM
YDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018374
ORF Size 822 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018374.4
RefSeq Size 6514 bp
RefSeq ORF 825 bp
Locus ID 54664
UniProt ID Q9NUM4
Cytogenetics 7p21.3
Protein Families Transmembrane
MW 31.1 kDa
Gene Summary Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

1 Product Review(s) 1 star1 star1 star1 star1 star Submit review

1 star1 star1 star1 star1 star

I used this plasmid for transient transfection in HEK293 cells, and it worked pretty well for me. Two days after transfection, I lysed the cells and ran the cell lysates on Western Blot and got good expression signal at the right size by anti-myc antibody.

Chenxu G. on 03/23/2023

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.