GLIS3 (NM_152629) Human Tagged ORF Clone

CAT#: RC206232

GLIS3 (Myc-DDK-tagged)-Human GLIS family zinc finger 3 (GLIS3), transcript variant 2

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLIS3 (NM_152629) Human Tagged ORF Clone
Symbol GLIS3
Synonyms NDH; ZNF515
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206232 representing NM_152629
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGTTCAGCGACTGGGACTCATTTCACCTCCAGCAAGCCAGGTCTCTACAGCATGCAACCAGATCA
GTCCTAGCTTACAGAGGGCAATGAATGCAGCCAACCTGAATATACCTCCTTCAGATACCAGGTCCCTTAT
TTCGCGTGAGTCTTTGGCGTCCACGACCTTGAGTCTGACGGAAAGTCAGTCGGCCTCAAGCATGAAGCAG
GAGTGGTCCCAGGGCTACAGGGCCCTCCCTTCGCTCTCCAACCACGGCTCTCAGAATGGCCTTGATCTAG
GGGATCTCCTTAGCCTTCCTCCCGGGACATCCATGTCCAGCAATAGTGTCTCTAACTCATTACCATCCTA
CCTTTTTGGCACGGAAAGTAGCCACTCTCCTTACCCTAGTCCTCGGCACTCATCCACCAGGTCCCACTCG
GCCCGCTCCAAGAAGAGAGCGCTGTCCTTGTCCCCGCTGTCCGATGGCATCGGGATAGATTTCAATACCA
TCATCCGCACGTCGCCCACGTCCTTGGTGGCCTACATCAACGGGTCGAGGGCTTCGCCGGCCAACCTGTC
CCCGCAGCCGGAGGTCTACGGGCATTTCCTGGGCGTGCGCGGCAGCTGCATTCCCCAGCCGCGCCCGGTG
CCCGGCAGCCAGAAGGGCGTGCTGGTGGCCCCTGGAGGCCTGGCGCTGCCGGCCTACGGCGAGGACGGGG
CCCTGGAGCACGAGCGCATGCAACAGCTGGAGCACGGCGGCCTGCAGCCAGGCCTGGTCAACCACATGGT
GGTGCAGCATGGCCTGCCGGGCCCCGACAGCCAGTCGGCCGGCCTGTTCAAGACCGAACGCCTGGAGGAG
TTCCCGGGCAGCACCGTAGACCTACCCCCCGCGCCTCCGCTCCCTCCTCTGCCGCCGCCCCCAGGCCCCC
CACCCCCTTACCATGCCCATGCGCACCTTCACCACCCGGAGCTCGGGCCCCACGCCCAGCAGCTGGCCTT
GCCCCAGGCCACCCTGGACGACGACGGGGAGATGGACGGCATCGGGGGCAAGCATTGCTGCCGCTGGATC
GACTGCAGCGCCCTGTACGACCAGCAGGAGGAGCTCGTGCGGCACATCGAGAAGGTCCACATCGACCAGC
GCAAAGGGGAGGACTTCACTTGCTTCTGGGCCGGTTGCCCTCGAAGATACAAGCCCTTCAACGCCCGCTA
TAAACTGCTGATCCACATGAGAGTCCACTCTGGGGAGAAGCCCAACAAGTGTACGTTTGAAGGTTGCGAG
AAGGCCTTTTCAAGGCTTGAAAATCTCAAGATCCACTTGCGGAGCCACACAGGCGAGAAGCCGTATTTGT
GCCAGCATCCGGGTTGTCAGAAGGCCTTCAGTAACTCCAGTGACCGCGCCAAACACCAGCGGACGCATCT
GGACACCAAACCTTATGCTTGTCAAATTCCAGGATGTACCAAACGCTACACAGACCCAAGTTCCCTAAGA
AAGCATGTGAAGGCACATTCTTCCAAAGAGCAACAAGCAAGGAAAAAGTTGCGGTCCAGCACAGAGCTCC
ATCCAGACCTGCTCACAGATTGCCTCACCGTGCAGTCCCTGCAGCCGGCCACTTCCCCTAGAGATGCTGC
TGCTGAAGGGACCGTGGGACGCTCCCCTGGACCCGGGCCTGACCTCTATTCAGCTCCCATTTTCTCCAGC
AATTATTCAAGCCGAAGTGGAACAGCTGCTGGGGCCGTACCACCCCCACATCCTGTCAGTCACCCTTCTC
CAGGACATAATGTACAGGGGAGCCCTCACAACCCCTCCTCCCAGTTACCTCCACTCACAGCTGTGGACGC
AGGAGCTGAGAGGTTTGCACCTTCTGCTCCATCTCCTCACCACATCAGCCCCCGGAGAGTTCCAGCTCCT
TCTTCAATACTGCAAAGAACACAGCCTCCCTATACCCAGCAGCCATCAGGTTCACACCTGAAGTCCTATC
AGCCAGAAACAAACTCTTCTTTTCAACCAAATGGTATCCATGTCCATGGATTTTATGGGCAGCTGCAGAA
GTTCTGTCCCCCACACTACCCCGATTCCCAGAGAATTGTGCCGCCTGTCAGCTCCTGCAGTGTGGTGCCT
TCGTTTGAGGACTGCCTAGTCCCTACATCCATGGGCCAGGCCAGTTTTGATGTTTTCCACAGAGCCTTCT
CGACTCACTCGGGCATTACAGTGTATGATTTACCTTCAAGTTCCTCGAGCCTCTTTGGGGAGTCTCTCCG
CAGCGGGGCTGAAGATGCTACCTTCTTGCAGATCAGCACCGTGGACCGCTGTCCTAGCCAGCTCTCCTCT
GTCTACACCGAAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206232 representing NM_152629
Red=Cloning site Green=Tags(s)

MMVQRLGLISPPASQVSTACNQISPSLQRAMNAANLNIPPSDTRSLISRESLASTTLSLTESQSASSMKQ
EWSQGYRALPSLSNHGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFGTESSHSPYPSPRHSSTRSHS
ARSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSRASPANLSPQPEVYGHFLGVRGSCIPQPRPV
PGSQKGVLVAPGGLALPAYGEDGALEHERMQQLEHGGLQPGLVNHMVVQHGLPGPDSQSAGLFKTERLEE
FPGSTVDLPPAPPLPPLPPPPGPPPPYHAHAHLHHPELGPHAQQLALPQATLDDDGEMDGIGGKHCCRWI
DCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCE
KAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLR
KHVKAHSSKEQQARKKLRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSS
NYSSRSGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAP
SSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGIHVHGFYGQLQKFCPPHYPDSQRIVPPVSSCSVVP
SFEDCLVPTSMGQASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVDRCPSQLSS
VYTEG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_152629
ORF Size 2325 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_152629.1, NM_152629.2, NM_152629.3, NP_689842
RefSeq Size 6672
RefSeq ORF 2328
Locus ID 169792
Cytogenetics 9p24.2
MW 83.5 kDa
Gene Summary This gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear protein with five C2H2-type zinc finger domains. This protein functions as both a repressor and activator of transcription and is specifically involved in the development of pancreatic beta cells, the thyroid, eye, liver and kidney. Mutations in this gene have been associated with neonatal diabetes and congenital hypothyroidism (NDH). Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only two have been determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations