TXNDC (TMX1) (NM_030755) Human Tagged ORF Clone

CAT#: RC206187

Reviews ()
Write a review

TMX1 (Myc-DDK-tagged)-Human thioredoxin-related transmembrane protein 1 (TMX1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TMX1
Synonyms PDIA11; TMX; TXNDC; TXNDC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206187 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCTCCGGGAGTCTTGCAGTTCCCCTGGCAGTCATGGTGCCGTTGCTTTGGGGTGCTCCCTGGA
CGCACGGGCGGCGGAGCAACGTTCGCGTCATCACGGACGAGAACTGGAGAGAACTGCTGGAAGGAGACTG
GATGATAGAATTTTATGCCCCGTGGTGCCCTGCTTGTCAAAATCTTCAACCGGAATGGGAAAGTTTTGCT
GAATGGGGAGAAGATCTTGAGGTTAATATTGCGAAAGTAGATGTCACAGAGCAGCCAGGACTGAGTGGAC
GGTTTATCATAAATGCTCTTCCTACTATTTATCATTGTAAAGATGGTGAATTTAGGCGCTATCAGGGTCC
AAGGACTAAGAAGGACTTCATAAACTTTATAAGTGATAAAGAGTGGAAGAGTATTGAGCCCGTTTCATCA
TGGTTTGGTCCAGGTTCTGTTCTGATGAGTAGTATGTCAGCACTCTTTCAGCTATCTATGTGGATCAGGA
CGTGCCATAACTACTTTATTGAAGACCTTGGATTGCCAGTGTGGGGATCATATACTGTTTTTGCTTTAGC
AACTCTGTTTTCCGGACTGTTATTAGGACTCTGTATGATATTTGTGGCAGATTGCCTTTGTCCTTCAAAA
AGGCGCAGACCACAGCCATACCCATACCCTTCAAAAAAATTATTATCAGAATCTGCACAACCTTTGAAAA
AAGTGGAGGAGGAACAAGAGGCGGATGAAGAAGATGTTTCAGAAGAAGAAGCTGAAAGTAAAGAAGGAAC
AAACAAAGACTTTCCACAGAATGCCATAAGACAACGCTCTCTGGGTCCATCATTGGCCACAGATAAATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206187 protein sequence
Red=Cloning site Green=Tags(s)

MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFA
EWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSS
WFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSK
RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_030755
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_030755.3, NP_110382.2
RefSeq Size 4119 bp
RefSeq ORF 843 bp
Locus ID 81542
UniProt ID Q9H3N1
Cytogenetics 14q22.1
Domains thiored
Protein Families Druggable Genome, Transcription Factors, Transmembrane
MW 31.8 kDa
Gene Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides. [provided by RefSeq, Jan 2017]
Other products for "TMX1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.