CDHH (CDH13) (NM_001257) Human Tagged ORF Clone

CAT#: RC206068

Reviews ()
Write a review

CDH13 (Myc-DDK-tagged)-Human cadherin 13, H-cadherin (heart) (CDH13), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CDH13
Synonyms CDHH; P105
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206068 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCGAGAACTCCGCTCGTTCTGTGCGTTCTCCTGTCCCAGGTGCTGCTGCTAACATCTGCAGAAG
ATTTGGACTGCACTCCTGGATTTCAGCAGAAAGTGTTCCATATCAATCAGCCAGCTGAATTCATTGAGGA
CCAGTCAATTCTAAACTTGACCTTCAGTGACTGTAAGGGAAACGACAAGCTACGCTATGAGGTCTCGAGC
CCATACTTCAAGGTGAACAGCGATGGCGGCTTAGTTGCTCTGAGAAACATAACTGCAGTGGGCAAAACTC
TGTTCGTCCATGCACGGACCCCCCATGCGGAAGATATGGCAGAACTCGTGATTGTCGGGGGGAAAGACAT
CCAGGGCTCCTTGCAGGATATATTTAAATTTGCAAGAACTTCTCCTGTCCCAAGACAAAAGAGGTCCATT
GTGGTATCTCCCATTTTAATTCCAGAGAATCAGAGACAGCCTTTCCCAAGAGATGTTGGCAAGGTAGTCG
ATAGTGACAGGCCAGAAAGGTCCAAGTTCCGGCTCACTGGAAAGGGAGTGGATCAAGAGCCTAAAGGAAT
TTTCAGAATCAATGAGAACACAGGGAGCGTCTCCATGACACGGACCTTGGACAGAGAAGTAATCGCTGTT
TATCAACTATTTGTGGAGACCACTGATGTCAATGGCAAAACTCTCGAGGGGCCGGTGCCTCTGGAAGTCA
TTGTGATTGATCAGAATGACAACCGACCGATCTTTCGGGAAGGCCCCTACATCGGCCACGTCATGGAAGG
GTCACCCACAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCC
CTCCTGCGGTATAATATCCGTCGGCAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTG
AGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGACCGAGAGACTCTGGAAAATCCCAAGTA
TGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACAGCCACG
ATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGG
AAGGAGCTGTGGGAGTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCGCCACAGGTGCATGGAG
GGCTGCCTACACCATCATCAACGGAAACCCCGGGCAGAGCTTTGAAATCCACACCAACCCTCAAACCAAC
GAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCACACCCTGCTGATCAAAG
TGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCAC
TGTCCTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTC
TCTGTGGGCAGCGTGCTGCTGACAGTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGT
ATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCCATCAATGGGACTGTTGACACCACAGC
TGTGCTGGACCGTGAGTCCACATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATTGACAGT
GGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGT
TCATTTACCCCACAGTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATC
AGATAAGGATCTTCACCCGAATACAGATCCTTTCAAATTTGAAATCCACAAACAAGCTGTTCCTGATAAA
GTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAAAATCTGAACAAAGCAA
ACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGT
ACAAGTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCGGGGGCCCTGCGCTTCAGCCTGCCC
TCAGTCCTGCTCCTCAGCCTCTTCAGCTTAGCTTGTCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206068 protein sequence
Red=Cloning site Green=Tags(s)

MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSS
PYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSI
VVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSMTRTLDREVIAV
YQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNA
LLRYNIRRQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATAT
IMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPATGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDL
SVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESTFVDNSVYTALFLAIDS
GNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDK
VWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLP
SVLLLSLFSLACL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001257
ORF Size 2139 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001257.5
RefSeq Size 4028 bp
RefSeq ORF 2142 bp
Locus ID 1012
UniProt ID P55290
Cytogenetics 16q23.3
Domains CA
MW 78.3 kDa
Gene Summary This gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of other cadherins, and so is not thought to be a cell-cell adhesion glycoprotein. This protein acts as a negative regulator of axon growth during neural differentiation. It also protects vascular endothelial cells from apoptosis due to oxidative stress, and is associated with resistance to atherosclerosis. The gene is hypermethylated in many types of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2011]
Other products for "CDH13"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.