SLC20A2 (NM_006749) Human Tagged ORF Clone

CAT#: RC206029

Reviews ()
Write a review

SLC20A2 (Myc-DDK-tagged)-Human solute carrier family 20 (phosphate transporter), member 2 (SLC20A2)



  "NM_006749" in other vectors (6)

Reconstitution Protocol

USD 607.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SLC20A2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC20A2
Synonyms GLVR-2; GLVR2; IBGC1; IBGC2; IBGC3; MLVAR; PIT-2; PIT2; Ram-1; RAM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206029 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGGATGAGTATTTGTGGATGGTCATTTTGGGTTTCATCATAGCTTTCATCTTGGCCTTTTCTG
TTGGTGCAAACGATGTTGCCAACTCCTTTGGTACAGCCGTGGGCTCTGGTGTGGTGACCTTGAGGCAGGC
ATGCATTTTAGCTTCAATATTTGAAACCACCGGCTCCGTGTTACTAGGCGCCAAAGTAGGAGAAACCATT
CGCAAAGGTATCATTGACGTGAACCTGTACAACGAGACGGTGGAGACTCTCATGGCTGGGGAAGTTAGTG
CCATGGTTGGTTCCGCTGTGTGGCAGCTGATTGCTTCCTTCCTGAGGCTTCCAATCTCAGGAACGCACTG
CATTGTGGGTTCTACTATAGGATTCTCACTGGTCGCAATCGGTACCAAAGGTGTGCAGTGGATGGAGCTT
GTCAAGATTGTTGCTTCTTGGTTTATATCTCCACTGTTGTCTGGTTTCATGTCTGGCCTGCTGTTTGTAC
TCATCAGAATTTTCATCTTAAAAAAGGAAGACCCTGTTCCCAATGGCCTCCGGGCACTCCCAGTATTCTA
TGCTGCTACCATAGCAATCAATGTCTTTTCCATCATGTACACAGGAGCACCAGTGCTCGGCCTTGTTCTC
CCCATGTGGGCCATAGCCCTCATTTCCTTTGGTGTCGCCCTCCTGTTCGCTTTTTTTGTGTGGCTCTTCG
TGTGTCCGTGGATGCGGAGGAAAATAACAGGCAAATTACAAAAAGAAGGTGCTTTATCACGAGTATCTGA
CGAAAGCCTCAGTAAGGTTCAGGAAGCAGAGTCCCCAGTATTTAAAGAGCTACCAGGTGCCAAGGCTAAT
GATGACAGCACCATCCCGCTCACGGGAGCAGCAGGGGAGACACTGGGGACCTCGGAAGGCACTTCTGCGG
GCAGCCACCCTCGGGCTGCATACGGAAGAGCACTGTCCATGACCCATGGCTCTGTGAAATCGCCCATCTC
CAACGGCACCTTCGGCTTCGACGGCCACACCAGGAGCGACGGTCATGTGTACCACACCGTGCACAAAGAC
TCGGGGCTCTACAAAGATCTGCTGCACAAAATCCACATCGACAGGGGCCCCGAGGAGAAGCCAGCCCAGG
AAAGCAACTACCGGCTGCTGCGCCGAAACAACAGTTACACCTGCTACACCGCAGCCATTTGTGGGCTGCC
AGTGCACGCCACCTTTCGAGCTGCGGACTCATCGGCCCCAGAGGACAGTGAGAAGCTGGTGGGCGACACC
GTGTCCTACTCCAAGAAGAGGCTGCGCTACGACAGCTACTCGAGCTACTGTAACGCGGTGGCAGAGGCGG
AGATCGAGGCGGAGGAGGGCGGCGTGGAGATGAAGCTGGCGTCGGAGCTGGCCGACCCTGACCAGCCGCG
AGAGGACCCTGCAGAGGAGGAGAAGGAGGAGAAGGACGCACCCGAGGTTCACCTCCTGTTCCATTTCCTG
CAGGTCCTCACCGCCTGTTTCGGGTCCTTTGCTCACGGCGGCAATGACGTGAGTAATGCCATCGGTCCCC
TGGTAGCCTTGTGGCTGATTTACAAACAAGGCGGGGTAACGCAAGAAGCAGCTACACCCGTCTGGCTGCT
GTTTTATGGAGGAGTTGGAATCTGCACAGGCCTCTGGGTCTGGGGGAGAAGAGTGATCCAGACCATGGGG
AAGGACCTCACTCCCATCACGCCGTCCAGCGGCTTCACGATCGAGCTGGCCTCAGCCTTCACAGTGGTGA
TCGCCTCCAACATCGGGCTTCCAGTCAGCACCACGCACTGTAAGGTGGGCTCGGTGGTGGCCGTGGGCTG
GATCCGCTCCCGCAAGGCTGTGGACTGGCGCCTCTTTCGGAACATCTTCGTGGCCTGGTTCGTGACCGTC
CCTGTGGCTGGGCTGTTCAGCGCTGCTGTCATGGCTCTTCTCATGTATGGGATCCTTCCATATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206029 protein sequence
Red=Cloning site Green=Tags(s)

MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETI
RKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMEL
VKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVLGLVL
PMWAIALISFGVALLFAFFVWLFVCPWMRRKITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKAN
DDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKD
SGLYKDLLHKIHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT
VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDAPEVHLLFHFL
QVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMG
KDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTV
PVAGLFSAAVMALLMYGILPYV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006749
ORF Size 1956 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006749.5
RefSeq Size 3971 bp
RefSeq ORF 1959 bp
Locus ID 6575
UniProt ID Q08357
Cytogenetics 8p11.21
Domains PHO4
Protein Families Druggable Genome, Transmembrane
MW 70.4 kDa
Gene Summary This gene encodes a member of the inorganic phosphate transporter family. The encoded protein is a type 3 sodium-dependent phosphate symporter that plays an important role in phosphate homeostasis by mediating cellular phosphate uptake. The encoded protein also confers susceptibility to viral infection as a gamma-retroviral receptor. Mutations in this gene may play a role in familial idiopathic basal ganglia calcification. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.