VPS45A (VPS45) (NM_007259) Human Tagged ORF Clone

CAT#: RC206027

Reviews ()
Write a review

VPS45 (Myc-DDK-tagged)-Human vacuolar protein sorting 45 homolog (S. cerevisiae) (VPS45)



  "NM_007259" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VPS45
Synonyms H1; H1VPS45; SCN5; VPS45A; VPS45B; VPS54A; VSP45; VSP45A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206027 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGTGGTTTTTGCTGTGAAGCAGTACATTTCCAAAATGATAGAGGACAGCGGGCCTGGTATGAAAG
TACTTCTCATGGATAAAGAGACGACTGGCATAGTGAGTATGGTATACACACAATCGGAGATTCTACAGAA
GGAAGTGTACCTCTTTGAACGCATTGATTCTCAAAATCGAGAGATCATGAAACACCTGAAGGCAATTTGT
TTTCTTCGACCTACAAAGGAGAATGTGGATTATATTATTCAGGAGCTCCGAAGACCCAAATACACTATAT
ATTTCATTTATTTCAGTAATGTGATCAGCAAGAGTGACGTGAAGTCATTGGCTGAAGCTGATGAACAGGA
AGTTGTGGCTGAGGTTCAGGAATTTTATGGTGATTACATTGCTGTGAACCCACATTTGTTTTCCCTCAAT
ATTTTGGGTTGCTGCCAGGGTCGAAATTGGGATCCAGCCCAGCTATCTAGAACAACTCAAGGGCTTACAG
CTCTCCTTTTATCTCTGAAGAAGTGTCCCATGATTCGTTATCAGCTCTCATCAGAGGCAGCAAAGAGACT
TGCAGAGTGCGTTAAGCAAGTGATAACTAAAGAATATGAACTGTTTGAATTCCGTCGGACAGAGGTTCCT
CCATTGCTCCTTATTTTAGATCGCTGTGATGATGCCATCACCCCATTGCTAAACCAGTGGACATATCAGG
CCATGGTCCACGAACTACTAGGCATAAACAACAATCGGATTGATCTTTCCAGAGTGCCGGGAATCAGTAA
AGACTTAAGAGAAGTGGTCCTATCTGCTGAAAATGATGAATTCTATGCTAATAATATGTACCTGAACTTT
GCTGAGATTGGTAGCAATATAAAGAATCTCATGGAAGATTTTCAGAAGAAGAAACCAAAAGAACAGCAAA
AACTAGAATCAATAGCAGACATGAAGGCGTTTGTTGAGAATTATCCACAGTTCAAGAAAATGTCTGGGAC
TGTTTCAAAGCATGTGACAGTGGTTGGAGAACTGTCTCGATTGGTCAGTGAACGGAATCTGCTGGAGGTT
TCAGAGGTTGAGCAAGAACTGGCCTGTCAAAATGACCATTCTAGTGCTCTCCAGAATATAAAAAGGCTTC
TGCAGAACCCCAAAGTGACAGAGTTTGATGCTGCCCGCCTGGTGATGCTTTATGCTTTACATTATGAGCG
ACACAGCAGCAATAGCCTGCCAGGACTAATGATGGACCTCAGGAATAAAGGTGTTTCTGAGAAGTATCGA
AAGCTCGTGTCTGCAGTTGTTGAATATGGTGGTAAACGAGTCAGAGGAAGTGACCTCTTCAGCCCCAAAG
ATGCTGTGGCTATCACCAAACAATTCCTCAAAGGACTGAAGGGAGTAGAAAATGTATATACACAGCATCA
ACCTTTCCTACATGAAACCCTGGATCATCTCATCAAAGGAAGGCTTAAGGAAAACCTATATCCTTATTTA
GGCCCCAGCACACTCAGAGACAGACCTCAGGATATCATTGTGTTTGTAATTGGAGGAGCCACCTATGAAG
AGGCTCTAACAGTTTATAACCTGAACCGCACCACTCCTGGAGTGAGGATTGTCCTGGGAGGCACCACAGT
GCACAACACGAAAAGTTTCCTAGAGGAAGTTCTGGCTTCTGGACTGCACAGCCGAAGCAAGGAGAGCTCT
CAAGTCACATCAAGGTCAGCGAGCAGAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206027 protein sequence
Red=Cloning site Green=Tags(s)

MNVVFAVKQYISKMIEDSGPGMKVLLMDKETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAIC
FLRPTKENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVAEVQEFYGDYIAVNPHLFSLN
ILGCCQGRNWDPAQLSRTTQGLTALLLSLKKCPMIRYQLSSEAAKRLAECVKQVITKEYELFEFRRTEVP
PLLLILDRCDDAITPLLNQWTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNF
AEIGSNIKNLMEDFQKKKPKEQQKLESIADMKAFVENYPQFKKMSGTVSKHVTVVGELSRLVSERNLLEV
SEVEQELACQNDHSSALQNIKRLLQNPKVTEFDAARLVMLYALHYERHSSNSLPGLMMDLRNKGVSEKYR
KLVSAVVEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDHLIKGRLKENLYPYL
GPSTLRDRPQDIIVFVIGGATYEEALTVYNLNRTTPGVRIVLGGTTVHNTKSFLEEVLASGLHSRSKESS
QVTSRSASRR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007259
ORF Size 1710 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007259.5
RefSeq Size 2824 bp
RefSeq ORF 1713 bp
Locus ID 11311
UniProt ID Q9NRW7
Cytogenetics 1q21.2
Domains Sec1
Protein Pathways Endocytosis
MW 65.1 kDa
Gene Summary Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec1 domain family, and shows a high degree of sequence similarity to mouse, rat and yeast Vps45. The exact function of this gene is not known, but its high expression in peripheral blood mononuclear cells suggests a role in trafficking proteins, including inflammatory mediators. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]

Other Versions

Other products for "VPS45"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.