Metallothionein (MT1A) (NM_005946) Human Tagged ORF Clone

CAT#: RC205942

MT1A (Myc-DDK-tagged)-Human metallothionein 1A (MT1A)

Product Images

Western blot validation of overexpression lysate (Cat# LY416963) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205942 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified MT1A protein (Cat# TP305942). The protein was produced from HEK293T cells transfected with MT1A cDNA clone (Cat# RC205942) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Metallothionein
• Synonyms: MT-1A; MT-IA; MT1; MT1S; MTC
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205942 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACCCCAACTGCTCCTGCGCCACTGGTGGCTCCTGCACCTGCACTGGCTCCTGCAAATGCAAAGAGT
  GCAAATGCAACTCCTGCAAGAAGAGCTGCTGCTCCTGCTGCCCCATGAGCTGTGCCAAGTGTGCCCAGGG
  CTGCATCTGCAAAGGGGCATCAGAGAAGTGCAGCTGCTGTGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205942 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCCA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005946
• ORF Size: 183 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005946.1
• RefSeq Size: 468 bp
• RefSeq ORF: 186 bp
• Locus ID: 4489
• UniProt ID: P04731
• Cytogenetics: 16q13
• MW: 6.1 kDa
• Gene Summary: This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. The conserved cysteine residues co-ordinate metal ions using mercaptide linkages. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. Disruption of two metallothionein genes in mouse resulted in defects in protection against heavy metals, oxidative stress, immune reactions, carcinogens, and displayed obesity. [provided by RefSeq, Sep 2017]