DHX15 (NM_001358) Human Tagged ORF Clone

CAT#: RC205914

DHX15 (Myc-DDK-tagged)-Human DEAH (Asp-Glu-Ala-His) box polypeptide 15 (DHX15)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DHX15 (NM_001358) Human Tagged ORF Clone
Symbol DHX15
Synonyms DBP1; DDX15; HRH2; PRP43; PRPF43; PrPp43p
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205914 representing NM_001358
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAAGCGGCACCGGTTGGACCTAGGGGAGGATTACCCCTCTGGCAAGAAGCGTGCGGGGACCGATG
GGAAGGATCGAGATCGAGACCGGGATCGTGAAGATCGGTCTAAAGATCGAGACCGAGAACGTGATAGAGG
AGATAGAGAGCGAGAGAGGGAGAAAGAAAAGGAGAAGGAGTTGCGAGCTTCAACAAATGCTATGCTTATC
AGTGCTGGATTACCACCTTTGAAAGCTTCCCATTCAGCTCACTCAACCCACTCAGCACATTCAACGCATT
CAACACATTCTGCTCATTCAACGCATGCCGGACATGCAGGTCACACGTCACTTCCACAGTGCATTAATCC
GTTCACCAACTTACCCCATACTCCTCGATACTATGATATTCTAAAGAAACGTCTTCAGCTCCCTGTTTGG
GAATACAAGGATAGGTTTACAGATATTCTGGTTAGACATCAGTCCTTTGTACTGGTTGGTGAGACTGGGT
CTGGTAAAACAACACAGATTCCACAGTGGTGTGTGGAGTACATGCGATCATTACCAGGACCCAAGAGAGG
AGTTGCCTGTACCCAACCCAGGAGAGTGGCTGCAATGAGTGTGGCTCAGAGAGTTGCTGATGAGATGGAT
GTGATGTTGGGCCAGGAAGTTGGTTACTCCATTCGATTTGAAGACTGCAGTAGTGCAAAAACCATTCTTA
AGTATATGACTGATGGGATGTTACTTCGTGAAGCTATGAATGATCCCCTCCTGGAGCGTTATGGTGTAAT
AATTCTTGATGAGGCTCATGAGAGGACACTGGCTACAGATATTCTAATGGGTGTTCTGAAGGAAGTTGTA
AGACAGAGATCAGATTTAAAGGTTATAGTTATGAGCGCTACTCTAGATGCAGGAAAATTCCAGATTTACT
TTGATAACTGTCCTCTCCTAACTATTCCTGGGCGTACACATCCTGTTGAGATCTTCTATACTCCAGAACC
AGAGAGAGATTATCTTGAAGCAGCAATTCGAACAGTTATCCAGATTCATATGTGTGAAGAGGAAGAGGGA
GATCTTCTTCTTTTCTTAACTGGTCAAGAGGAAATTGATGAAGCCTGTAAGAGAATAAAGCGTGAAGTTG
ATGATTTGGGCCCTGAAGTTGGTGACATTAAAATCATTCCATTGTATTCTACACTTCCACCTCAGCAGCA
GCAACGCATTTTTGAGCCTCCACCTCCCAAAAAACAGAATGGAGCAATTGGAAGAAAGGTAGTTGTGTCA
ACTAACATAGCAGAGACGTCTTTGACAATAGATGGTGTGGTGTTTGTGATTGATCCTGGATTTGCGAAAC
AGAAGGTCTACAATCCTCGAATCAGAGTTGAGTCCCTTTTGGTGACAGCTATTAGTAAAGCTTCAGCTCA
GCAAAGGGCTGGTCGAGCTGGACGTACCAGACCTGGAAAATGCTTCAGACTTTACACAGAGAAAGCTTAT
AAAACAGAAATGCAGGATAACACCTATCCTGAGATTTTGCGTTCTAATTTAGGATCAGTTGTGTTACAAT
TGAAGAAACTTGGTATTGATGACTTGGTACATTTTGATTTTATGGATCCACCAGCTCCTGAAACTCTGAT
GAGAGCCCTGGAACTTTTGAATTACCTGGCTGCTTTAAATGATGATGGAGATCTGACTGAATTGGGATCC
ATGATGGCAGAGTTTCCTCTAGATCCACAGCTCGCAAAAATGGTTATTGCAAGTTGTGACTACAACTGTT
CTAATGAGGTCCTATCTATTACTGCTATGTTGTCAGTCCCACAGTGTTTTGTTCGCCCCACGGAGGCCAA
GAAAGCCGCAGATGAGGCCAAGATGAGATTTGCCCACATAGATGGAGATCATCTGACACTGCTGAACGTC
TACCATGCTTTTAAACAAAATCATGAATCGGTTCAGTGGTGTTATGACAACTTCATTAACTACAGGTCCC
TGATGTCCGCAGACAATGTACGCCAGCAGCTATCTCGAATTATGGACAGATTTAATTTGCCTCGTCGAAG
TACTGACTTTACAAGCAGGGACTATTATATTAATATAAGAAAAGCTTTGGTTACTGGGTATTTTATGCAG
GTGGCACATTTAGAACGAACAGGGCATTACTTAACTGTGAAAGATAACCAGGTGGTTCAGTTGCATCCCT
CTACTGTTCTTGACCACAAACCTGAATGGGTGCTTTATAATGAGTTTGTTCTAACAACAAAGAATTACAT
CCGGACATGTACAGATATCAAGCCAGAATGGTTGGTGAAAATTGCCCCTCAATATTATGACATGAGCAAT
TTCCCACAGTGTGAAGCAAAGAGACAGTTGGACCGCATCATTGCCAAACTTCAATCCAAGGAATATTCAC
AGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205914 representing NM_001358
Red=Cloning site Green=Tags(s)

MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLI
SAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVW
EYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMD
VMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVV
RQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEG
DLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVS
TNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAY
KTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGS
MMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNV
YHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQ
VAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSN
FPQCEAKRQLDRIIAKLQSKEYSQY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001358
ORF Size 2385 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001358.2, NP_001349
RefSeq Size 3019
RefSeq ORF 2388
Locus ID 1665
Cytogenetics 4p15.2
Domains DEXDc, helicase_C, HA2
Protein Pathways Spliceosome
MW 90.8 kDa
Gene Summary The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)