HSPA5 (NM_005347) Human Tagged ORF Clone

CAT#: RC205859

HSPA5 (Myc-DDK-tagged)-Human heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) (HSPA5)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name HSPA5 (NM_005347) Human Tagged ORF Clone
Symbol HSPA5
Synonyms BIP; GRP78; HEL-S-89n; MIF2
Vector pCMV6-Entry
Sequence Data
>RC205859 representing NM_005347
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTCTCCCTGGTGGCCGCGATGCTGCTGCTGCTCAGCGCGGCGCGGGCCGAGGAGGAGGACAAGA
AGGAGGACGTGGGCACGGTGGTCGGCATCGACCTGGGGACCACCTACTCCTGCGTCGGCGTGTTCAAGAA
CGGCCGCGTGGAGATCATCGCCAACGATCAGGGCAACCGCATCACGCCGTCCTATGTCGCCTTCACTCCT
GAAGGGGAACGTCTGATTGGCGATGCCGCCAAGAACCAGCTCACCTCCAACCCCGAGAACACGGTCTTTG
ACGCCAAGCGGCTCATCGGCCGCACGTGGAATGACCCGTCTGTGCAGCAGGACATCAAGTTCTTGCCGTT
CAAGGTGGTTGAAAAGAAAACTAAACCATACATTCAAGTTGATATTGGAGGTGGGCAAACAAAGACATTT
GCTCCTGAAGAAATTTCTGCCATGGTTCTCACTAAAATGAAAGAAACCGCTGAGGCTTATTTGGGAAAGA
AGGTTACCCATGCAGTTGTTACTGTACCAGCCTATTTTAATGATGCCCAACGCCAAGCAACCAAAGACGC
TGGAACTATTGCTGGCCTAAATGTTATGAGGATCATCAACGAGCCTACGGCAGCTGCTATTGCTTATGGC
CTGGATAAGAGGGAGGGGGAGAAGAACATCCTGGTGTTTGACCTGGGTGGCGGAACCTTCGATGTGTCTC
TTCTCACCATTGACAATGGTGTCTTCGAAGTTGTGGCCACTAATGGAGATACTCATCTGGGTGGAGAAGA
CTTTGACCAGCGTGTCATGGAACACTTCATCAAACTGTACAAAAAGAAGACGGGCAAAGATGTCAGGAAA
GACAATAGAGCTGTGCAGAAACTCCGGCGCGAGGTAGAAAAGGCCAAACGGGCCCTGTCTTCTCAGCATC
AAGCAAGAATTGAAATTGAGTCCTTCTATGAAGGAGAAGACTTTTCTGAGACCCTGACTCGGGCCAAATT
TGAAGAGCTCAACATGGATCTGTTCCGGTCTACTATGAAGCCCGTCCAGAAAGTGTTGGAAGATTCTGAT
TTGAAGAAGTCTGATATTGATGAAATTGTTCTTGTTGGTGGCTCGACTCGAATTCCAAAGATTCAGCAAC
TGGTTAAAGAGTTCTTCAATGGCAAGGAACCATCCCGTGGCATAAACCCAGATGAAGCTGTAGCGTATGG
TGCTGCTGTCCAGGCTGGTGTGCTCTCTGGTGATCAAGATACAGGTGACCTGGTACTGCTTGATGTATGT
CCCCTTACACTTGGTATTGAAACTGTGGGAGGTGTCATGACCAAACTGATTCCAAGGAACACAGTGGTGC
CTACCAAGAAGTCTCAGATCTTTTCTACAGCTTCTGATAATCAACCAACTGTTACAATCAAGGTCTATGA
AGGTGAAAGACCCCTGACAAAAGACAATCATCTTCTGGGTACATTTGATCTGACTGGAATTCCTCCTGCT
CCTCGTGGGGTCCCACAGATTGAAGTCACCTTTGAGATAGATGTGAATGGTATTCTTCGAGTGACAGCTG
AAGACAAGGGTACAGGGAACAAAAATAAGATCACAATCACCAATGACCAGAATCGCCTGACACCTGAAGA
AATCGAAAGGATGGTTAATGATGCTGAGAAGTTTGCTGAGGAAGACAAAAAGCTCAAGGAGCGCATTGAT
ACTAGAAATGAGTTGGAAAGCTATGCCTATTCTCTAAAGAATCAGATTGGAGATAAAGAAAAGCTGGGAG
GTAAACTTTCCTCTGAAGATAAGGAGACCATGGAAAAAGCTGTAGAAGAAAAGATTGAATGGCTGGAAAG
CCACCAAGATGCTGACATTGAAGACTTCAAAGCTAAGAAGAAGGAACTGGAAGAAATTGTTCAACCAATT
ATCAGCAAACTCTATGGAAGTGCAGGCCCTCCCCCAACTGGTGAAGAGGATACAGCAGAAAAAGATGAGT
TG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205859 representing NM_005347
Red=Cloning site Green=Tags(s)

MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP
EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF
APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG
LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK
DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD
LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA
PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID
TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI
ISKLYGSAGPPPTGEEDTAEKDEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005347
ORF Size 1962 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005347.1, NM_005347.2, NM_005347.3, NM_005347.4, NP_005338
RefSeq Size 3925
RefSeq ORF 1965
Locus ID 3309
Cytogenetics 9q33.3
Domains HSP70
Protein Families Druggable Genome
Protein Pathways Antigen processing and presentation, Prion diseases
MW 72.2 kDa
Gene Summary The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER. As this protein interacts with many ER proteins, it may play a key role in monitoring protein transport through the cell.[provided by RefSeq, Sep 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)