GRP78 (HSPA5) (NM_005347) Human Tagged ORF Clone

CAT#: RC205859

Reviews ()
Write a review
  • TrueORF®

HSPA5 (Myc-DDK-tagged)-Human heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) (HSPA5)



  "NM_005347" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 609.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "HSPA5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HSPA5
Synonyms BIP; GRP78; HEL-S-89n
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205859 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTCTCCCTGGTGGCCGCGATGCTGCTGCTGCTCAGCGCGGCGCGGGCCGAGGAGGAGGACAAGA
AGGAGGACGTGGGCACGGTGGTCGGCATCGACCTGGGGACCACCTACTCCTGCGTCGGCGTGTTCAAGAA
CGGCCGCGTGGAGATCATCGCCAACGATCAGGGCAACCGCATCACGCCGTCCTATGTCGCCTTCACTCCT
GAAGGGGAACGTCTGATTGGCGATGCCGCCAAGAACCAGCTCACCTCCAACCCCGAGAACACGGTCTTTG
ACGCCAAGCGGCTCATCGGCCGCACGTGGAATGACCCGTCTGTGCAGCAGGACATCAAGTTCTTGCCGTT
CAAGGTGGTTGAAAAGAAAACTAAACCATACATTCAAGTTGATATTGGAGGTGGGCAAACAAAGACATTT
GCTCCTGAAGAAATTTCTGCCATGGTTCTCACTAAAATGAAAGAAACCGCTGAGGCTTATTTGGGAAAGA
AGGTTACCCATGCAGTTGTTACTGTACCAGCCTATTTTAATGATGCCCAACGCCAAGCAACCAAAGACGC
TGGAACTATTGCTGGCCTAAATGTTATGAGGATCATCAACGAGCCTACGGCAGCTGCTATTGCTTATGGC
CTGGATAAGAGGGAGGGGGAGAAGAACATCCTGGTGTTTGACCTGGGTGGCGGAACCTTCGATGTGTCTC
TTCTCACCATTGACAATGGTGTCTTCGAAGTTGTGGCCACTAATGGAGATACTCATCTGGGTGGAGAAGA
CTTTGACCAGCGTGTCATGGAACACTTCATCAAACTGTACAAAAAGAAGACGGGCAAAGATGTCAGGAAA
GACAATAGAGCTGTGCAGAAACTCCGGCGCGAGGTAGAAAAGGCCAAACGGGCCCTGTCTTCTCAGCATC
AAGCAAGAATTGAAATTGAGTCCTTCTATGAAGGAGAAGACTTTTCTGAGACCCTGACTCGGGCCAAATT
TGAAGAGCTCAACATGGATCTGTTCCGGTCTACTATGAAGCCCGTCCAGAAAGTGTTGGAAGATTCTGAT
TTGAAGAAGTCTGATATTGATGAAATTGTTCTTGTTGGTGGCTCGACTCGAATTCCAAAGATTCAGCAAC
TGGTTAAAGAGTTCTTCAATGGCAAGGAACCATCCCGTGGCATAAACCCAGATGAAGCTGTAGCGTATGG
TGCTGCTGTCCAGGCTGGTGTGCTCTCTGGTGATCAAGATACAGGTGACCTGGTACTGCTTGATGTATGT
CCCCTTACACTTGGTATTGAAACTGTGGGAGGTGTCATGACCAAACTGATTCCAAGGAACACAGTGGTGC
CTACCAAGAAGTCTCAGATCTTTTCTACAGCTTCTGATAATCAACCAACTGTTACAATCAAGGTCTATGA
AGGTGAAAGACCCCTGACAAAAGACAATCATCTTCTGGGTACATTTGATCTGACTGGAATTCCTCCTGCT
CCTCGTGGGGTCCCACAGATTGAAGTCACCTTTGAGATAGATGTGAATGGTATTCTTCGAGTGACAGCTG
AAGACAAGGGTACAGGGAACAAAAATAAGATCACAATCACCAATGACCAGAATCGCCTGACACCTGAAGA
AATCGAAAGGATGGTTAATGATGCTGAGAAGTTTGCTGAGGAAGACAAAAAGCTCAAGGAGCGCATTGAT
ACTAGAAATGAGTTGGAAAGCTATGCCTATTCTCTAAAGAATCAGATTGGAGATAAAGAAAAGCTGGGAG
GTAAACTTTCCTCTGAAGATAAGGAGACCATGGAAAAAGCTGTAGAAGAAAAGATTGAATGGCTGGAAAG
CCACCAAGATGCTGACATTGAAGACTTCAAAGCTAAGAAGAAGGAACTGGAAGAAATTGTTCAACCAATT
ATCAGCAAACTCTATGGAAGTGCAGGCCCTCCCCCAACTGGTGAAGAGGATACAGCAGAAAAAGATGAGT
TG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205859 protein sequence
Red=Cloning site Green=Tags(s)

MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP
EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF
APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG
LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK
DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD
LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA
PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID
TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI
ISKLYGSAGPPPTGEEDTAEKDEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005347
ORF Size 1962 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005347.5
RefSeq Size 3973 bp
RefSeq ORF 1965 bp
Locus ID 3309
UniProt ID P11021
Cytogenetics 9q33.3
Domains HSP70
Protein Families Druggable Genome
Protein Pathways Antigen processing and presentation, Prion diseases
MW 72.3 kDa
Gene Summary The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. This protein localizes to the lumen of the endoplasmic reticulum (ER) where it operates as a typical HSP70 chaperone involved in the folding and assembly of proteins in the ER and is a master regulator of ER homeostasis. During cellular stress, as during viral infection or tumorogenesis, this protein interacts with the transmembrane stress sensor proteins PERK (protein kinase R-like endoplasmic reticulum kinase), IRE1 (inositol-requiring kinase 1), and ATF6 (activating transcription factor 6) where it acts as a repressor of the unfolded protein response (UPR) and also plays a role in cellular apoptosis and senescence. Elevated expression and atypical translocation of this protein to the cell surface has been reported in viral infections and some types of cancer cells. At the cell surface this protein may facilitate viral attachment and entry to host cells. This gene is a therapeutic target for the treatment of coronavirus diseases and chemoresistant cancers. [provided by RefSeq, Jul 2020]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Rabbit polyclonal anti-GRP78 / HSPA5 antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.