splicing factor 1(SF1) (NM_201998) Human Tagged ORF Clone

CAT#: RC205846

SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 3

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name splicing factor 1(SF1) (NM_201998) Human Tagged ORF Clone
Symbol SF1
Synonyms BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162
Vector pCMV6-Entry
Sequence Data
>RC205846 representing NM_201998
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACCGGAGCGAACGCCACGCCGTTGGACTTCCCAAGTAAGAAGCGGAAGAGGAGCCGCTGGAACC
AAGACACAATGGAACAGAAGACAGTGATTCCAGGAATGCCTACAGTTATTCCCCCTGGACTTACTCGAGA
ACAAGAAAGAGCTTATATAGTGCAACTGCAGATAGAAGACCTGACTCGTAAACTGCGCACAGGAGACCTG
GGCATCCCCCCTAACCCTGAGGACAGGTCCCCTTCCCCTGAGCCCATCTACAATAGCGAGGGGAAGCGGC
TTAACACCCGAGAGTTCCGCACCCGCAAAAAGCTGGAAGAGGAGCGGCACAACCTCATCACAGAGATGGT
TGCACTCAATCCGGATTTCAAGCCACCTGCAGATTACAAACCTCCAGCAACACGTGTGAGTGATAAAGTC
ATGATTCCACAAGATGAGTACCCAGAAATCAACTTTGTGGGGCTGCTCATCGGGCCCAGAGGGAACACCC
TGAAGAACATAGAGAAGGAGTGCAATGCCAAGATTATGATCCGGGGGAAAGGGTCTGTGAAAGAAGGGAA
GGTTGGGCGCAAAGATGGCCAGATGTTGCCAGGAGAAGATGAGCCACTTCATGCCCTGGTTACTGCCAAT
ACAATGGAGAACGTCAAAAAGGCAGTGGAACAGATAAGAAACATCCTGAAGCAGGGTATCGAGACTCCAG
AGGACCAGAATGATCTACGGAAGATGCAGCTTCGGGAGTTGGCTCGCTTAAATGGGACCCTTCGGGAAGA
CGATAACAGGATCTTAAGACCCTGGCAGAGCTCAGAGACCCGCAGCATTACCAACACCACAGTGTGTACC
AAGTGTGGAGGGGCTGGCCACATTGCTTCAGACTGTAAATTCCAAAGGCCTGGTGATCCTCAGTCAGCTC
AGGATAAAGCACGGATGGATAAAGAATATTTGTCCCTCATGGCTGAACTGGGTGAAGCACCTGTCCCAGC
ATCTGTGGGCTCCACCTCTGGGCCTGCCACCACACCCCTGGCCAGCGCACCTCGTCCTGCTGCTCCCGCC
AACAACCCACCTCCACCGTCTCTCATGTCTACCACCCAGAGCCGCCCACCCTGGATGAATTCTGGCCCTT
CAGAGAGTCGGCCCTACCACGGCATGCATGGAGGTGGTCCTGGTGGGCCCGGAGGTGGCCCCCACAGCTT
CCCACACCCATTACCCAGCCTGACAGGTGGGCATGGTGGACATCCCATGCAGCACAACCCCAATGGACCC
CCACCCCCTTGGATGCAGCCACCACCACCACCGATGAACCAGGGCCCCCACCCTCCTGGGCACCATGGCC
CTCCTCCAATGGATCAGTACCTGGGAAGTACGCCTGTGGGCTCTGGGGTCTATCGCCTGCATCAAGGAAA
AGGTATGATGCCGCCACCACCTATGGGCATGATGCCGCCGCCGCCGCCGCCTCCCAGTGGGCAGCCCCCA
CCCCCTCCCTCTGGTCCTCTTCCCCCATGGCAACAACAGCAGCAGCAGCCTCCGCCACCCCCTCCGCCCA
GCAGCAGTATGGCTTCCAGTACCCCCTTGCCATGGCAGCAAAGATCCCTCCCCGCGGCGGCGATGGCCCG
AGCCATGAGAGTGAGGACTTTCCGCGCCCATTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205846 representing NM_201998
Red=Cloning site Green=Tags(s)

MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL
GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV
MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN
TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT
KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA
NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP
PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAAAMARAMRVRTFRAHW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_201998
ORF Size 1644 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_201998.1, NM_201998.2, NP_973727
RefSeq Size 2890
RefSeq ORF 1647
Locus ID 7536
Cytogenetics 11q13.1
Protein Families Transcription Factors
MW 59.5 kDa
Gene Summary This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.