BubR1 (BUB1B) (NM_001211) Human Tagged ORF Clone

USD 98.00

USD 800.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BubR1 (BUB1B) (NM_001211) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BUB1B
Synonyms Bub1A; BUB1beta; BUBR1; hBUBR1; MAD3L; MVA1; SSK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205844 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGTGAAGAAGGAAGGGGGTGCTCTGAGTGAAGCCATGTCCCTGGAGGGAGATGAATGGGAAC
TGAGTAAAGAAAATGTACAACCTTTAAGGCAAGGGCGGATCATGTCCACGCTTCAGGGAGCACTGGCACA
AGAATCTGCCTGTAACAATACTCTTCAGCAGCAGAAACGGGCATTTGAATATGAAATTCGATTTTACACT
GGAAATGACCCTCTGGATGTTTGGGATAGGTATATCAGCTGGACAGAGCAGAACTATCCTCAAGGTGGGA
AGGAGAGTAATATGTCAACGTTATTAGAAAGAGCTGTAGAAGCACTACAAGGAGAAAAACGATATTATAG
TGATCCTCGATTTCTCAATCTCTGGCTTAAATTAGGGCGTTTATGCAATGAGCCTTTGGATATGTACAGT
TACTTGCACAACCAAGGGATTGGTGTTTCACTTGCTCAGTTCTATATCTCATGGGCAGAAGAATATGAAG
CTAGAGAAAACTTTAGGAAAGCAGATGCGATATTTCAGGAAGGGATTCAACAGAAGGCTGAACCACTAGA
AAGACTACAGTCCCAGCACCGACAATTCCAAGCTCGAGTGTCTCGGCAAACTCTGTTGGCACTTGAGAAA
GAAGAAGAGGAGGAAGTTTTTGAGTCTTCTGTACCACAACGAAGCACACTAGCTGAACTAAAGAGCAAAG
GGAAAAAGACAGCAAGAGCTCCAATCATCCGTGTAGGAGGTGCTCTCAAGGCTCCAAGCCAGAACAGAGG
ACTCCAAAATCCATTTCCTCAACAGATGCAAAATAATAGTAGAATTACTGTTTTTGATGAAAATGCTGAT
GAGGCTTCTACAGCAGAGTTGTCTAAGCCTACAGTCCAGCCATGGATAGCACCCCCCATGCCCAGGGCCA
AAGAGAATGAGCTGCAAGCAGGCCCTTGGAACACAGGCAGGTCCTTGGAACACAGGCCTCGTGGCAATAC
AGCTTCACTGATAGCTGTACCCGCTGTGCTTCCCAGTTTCACTCCATATGTGGAAGAGACTGCACAACAG
CCAGTTATGACACCATGTAAAATTGAACCTAGTATAAACCACATCCTAAGCACCAGAAAGCCTGGAAAGG
AAGAAGGAGATTCTCTACAAAGGGTTCAGAGCCATCAGCAAGCGTCTGAGGAGAAGAAAGAGAAGATGAT
GTATTGTAAGGAGAAGATTTATGCAGGAGTAGGGGAATTCTCCTTTGAAGAAATTCGGGCTGAAGTTTTC
CGGAAGAAATTAAAAGAGCAAAGGGAAGCCGAGCTATTGACCAGTGCAGAGAAGAGAGCAGAAATGCAGA
AACAGATTGAAGAGATGGAGAAGAAGCTAAAAGAAATCCAAACTACTCAGCAAGAAAGAACAGGTGATCA
GCAAGAAGAGACGATGCCTACAAAGGAGACAACTAAACTGCAAATTGCTTCCGAGTCTCAGAAAATACCA
GGAATGACTCTATCCAGTTCTGTTTGTCAAGTAAACTGTTGTGCCAGAGAAACTTCACTTGCGGAGAACA
TTTGGCAGGAACAACCTCATTCTAAAGGTCCCAGTGTACCTTTCTCCATTTTTGATGAGTTTCTTCTTTC
AGAAAAGAAGAATAAAAGTCCTCCTGCAGATCCCCCACGAGTTTTAGCTCAACGAAGACCCCTTGCAGTT
CTCAAAACCTCAGAAAGCATCACCTCAAATGAAGATGTGTCTCCAGATGTTTGTGATGAATTTACAGGAA
TTGAACCCTTGAGCGAGGATGCCATTATCACAGGCTTCAGAAATGTAACAATTTGTCCTAACCCAGAAGA
CACTTGTGACTTTGCCAGAGCAGCTCGTTTTGTATCCACTCCTTTTCATGAGATAATGTCCTTGAAGGAT
CTCCCTTCTGATCCTGAGAGACTGTTACCGGAAGAAGATCTAGATGTAAAGACCTCTGAGGACCAGCAGA
CAGCTTGTGGCACTATCTACAGTCAGACTCTCAGCATCAAGAAGCTGAGCCCAATTATTGAAGACAGTCG
TGAAGCCACACACTCCTCTGGCTTCTCTGGTTCTTCTGCCTCGGTTGCAAGCACCTCCTCCATCAAATGT
CTTCAAATTCCTGAGAAACTAGAACTTACTAATGAGACTTCAGAAAACCCTACTCAGTCACCATGGTGTT
CACAGTATCGCAGACAGCTACTGAAGTCCCTACCAGAGTTAAGTGCCTCTGCAGAGTTGTGTATAGAAGA
CAGACCAATGCCTAAGTTGGAAATTGAGAAGGAAATTGAATTAGGTAATGAGGATTACTGCATTAAACGA
GAATACCTAATATGTGAAGATTACAAGTTATTCTGGGTGGCGCCAAGAAACTCTGCAGAATTAACAGTAA
TAAAGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGA
AGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAAC
TGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTT
ATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTG
TCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTG
GACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTAC
AGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGC
AGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTT
AGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCA
ATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATT
CCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGCTTTGCTCTTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205844 protein sequence
Red=Cloning site Green=Tags(s)

MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYT
GNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYS
YLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEK
EEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENAD
EASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETAQQ
PVMTPCKIEPSINHILSTRKPGKEEGDSLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVF
RKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIP
GMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKD
LPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKC
LQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKR
EYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN
CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIV
DFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKL
SQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001211
ORF Size 3150 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001211.1, NM_001211.2, NM_001211.3, NM_001211.4, NM_001211.5, NP_001202.4
RefSeq Size 3749
RefSeq ORF 3153
Locus ID 701
Cytogenetics 15q15.1
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency
Protein Pathways Cell cycle
MW 119.5 kDa
Gene Summary This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "BUB1B"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


BuB1B (BubR1) mouse monoclonal antibody, clone OTI6E3 (formerly 6E3)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools