FAM126A (NM_032581) Human Tagged ORF Clone

CAT#: RC205807

FAM126A (Myc-DDK-tagged)-Human family with sequence similarity 126, member A (FAM126A)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FAM126A (NM_032581) Human Tagged ORF Clone
Symbol FAM126A
Synonyms DRCTNNB1A; HCC; HLD5; HYCC1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205807 representing NM_032581
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTACTTCAGAGAAAGGGGTTGTGGAGGAATGGTTGTCAGAGTTTAAGACATTACCAGAAACATCTT
TACCAAATTATGCCACAAATTTGAAAGACAAGAGTTCTTTAGTTTCATCTCTCTATAAAGTTATCCAGGA
GCCACAAAGTGAGTTGCTAGAACCTGTCTGTCACCAGCTCTTTGAATTCTATCGCAGTGGAGAGGAGCAG
TTGCTTCAATTTACGCTGCAATTTCTCCCAGAACTAATTTGGTGCTACCTTGCAGTCTCAGCCAGCAGAA
ATGTGCATAGCAGTGGATGCATTGAAGCTCTTCTTCTAGGGGTTTACAATTTGGAAATAGTTGACAAACA
GGGACATACCAAAGTATTGAGTTTTACGATTCCATCTTTATCCAAACCATCTGTATACCATGAACCTTCC
AGCATTGGGTCCATGGCTCTGACTGAGAGTGCACTATCCCAGCATGGTTTGTCAAAAGTGGTATACAGTG
GACCTCATCCTCAAAGGGAGATGCTGACAGCACAGAATCGGTTTGAAGTGTTGACATTCCTTTTGTTGTG
TTACAATGCTGCCTTAACTTACATGCCCAGTGTTTCTCTTCAGTCACTGTGTCAAATTTGTTCAAGAATC
TGTGTTTGTGGATATCCTCGACAACATGTAAGAAAATATAAAGGTATAAGTAGCAGGATACCAGTTTCTT
CAGGATTCATGGTGCAAATGTTAACAGGGATTTATTTTGCCTTTTATAATGGAGAATGGGATCTAGCTCA
AAAAGCACTGGATGATATTATATACAGAGCCCAGCTAGAATTATATCCAGAGCCATTGCTGGTTGCTAAT
GCAATAAAGGCTTCATTGCCTCATGGTCCCATGAAATCTAATAAGGAAGGTACAAGGTGTATTCAAGTTG
AAATCACACCAACTTCCTCTCGAATATCAAGAAATGCAGTAACCAGCATGTCAATAAGGGGTCATAGGTG
GAAAAGACATGGAAATACAGAATTAACAGGTCAAGAAGAACTGATGGAGATATCTGAAGTTGACGAGGGA
TTTTATTCCAGGGCTGCGTCTAGTACCAGCCAGTCGGGTTTATCAAACAGTAGTCACAATTGTAGTAACA
AGCCAAGTATAGGAAAGAACCACAGACGGTCAGGAGGAAGCAAAACTGGAGGAAAAGAAAAAGAAACTAC
AGGGGAATCTTGCAAAGATCACTTTGCTCGAAAACAAACTCAGAGAGCCCAAAGTGAGAATCTTGAGCTT
CTCTCTTTGAAGAGACTTACTTTAACAACCAGCCAATCCCTACCTAAGCCTAGTAGCCATGGTTTGGCTA
AGACCGCAGCGACTGTATTTAGTAAATCCTTTGAACAAGTCAGTGGTGTCACAGTCCCACATAACCCGTC
ATCTGCTGTTGGTTGTGGGGCTGGGACAGATGCCAATAGGTTTTCCGCTTGTAGTCTCCAAGAAGAAAAG
CTTATTTACGTTTCAGAAAGAACTGAACTTCCAATGAAGCATCAATCAGGTCAGCAGAGACCTCCTAGTA
TTAGCATTACTCTGTCCACAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205807 representing NM_032581
Red=Cloning site Green=Tags(s)

MFTSEKGVVEEWLSEFKTLPETSLPNYATNLKDKSSLVSSLYKVIQEPQSELLEPVCHQLFEFYRSGEEQ
LLQFTLQFLPELIWCYLAVSASRNVHSSGCIEALLLGVYNLEIVDKQGHTKVLSFTIPSLSKPSVYHEPS
SIGSMALTESALSQHGLSKVVYSGPHPQREMLTAQNRFEVLTFLLLCYNAALTYMPSVSLQSLCQICSRI
CVCGYPRQHVRKYKGISSRIPVSSGFMVQMLTGIYFAFYNGEWDLAQKALDDIIYRAQLELYPEPLLVAN
AIKASLPHGPMKSNKEGTRCIQVEITPTSSRISRNAVTSMSIRGHRWKRHGNTELTGQEELMEISEVDEG
FYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGGKEKETTGESCKDHFARKQTQRAQSENLEL
LSLKRLTLTTSQSLPKPSSHGLAKTAATVFSKSFEQVSGVTVPHNPSSAVGCGAGTDANRFSACSLQEEK
LIYVSERTELPMKHQSGQQRPPSISITLSTD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032581
ORF Size 1563 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032581.1, NM_032581.2, NM_032581.3, NP_115970
RefSeq Size 3768
RefSeq ORF 1566
Locus ID 84668
Cytogenetics 7p15.3
MW 57.4 kDa
Gene Summary The protein encoded by this gene may play a part in the beta-catenin/Lef signaling pathway. Expression of this gene is down-regulated by beta-catenin. Defects in this gene are a cause of hypomyelination with congenital cataract (HCC). [provided by RefSeq, Oct 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations