DLX3 (NM_005220) Human Tagged ORF Clone

CAT#: RC205795

DLX3 (Myc-DDK-tagged)-Human distal-less homeobox 3 (DLX3)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_005220" in other vectors (7)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-DLX3 Antibody
    • 100 ul

USD 539.00

Other products for "DLX3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DLX3
Synonyms AI4; TDO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205795 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGCTCCTTCGATCGCAAGCTCAGCAGCATCCTCACCGACATCTCCAGCTCCCTTAGCTGCCATG
CGGGCTCCAAGGACTCGCCTACCCTGCCCGAGTCTTCTGTCACTGACCTGGGCTACTACAGCGCTCCCCA
GCACGATTACTACTCGGGCCAGCCCTATGGCCAGACGGTGAACCCCTACACCTACCACCACCAATTCAAT
CTCAATGGGCTTGCAGGCACGGGCGCTTACTCGCCCAAGTCGGAATATACCTACGGAGCCTCCTACCGGC
AATACGGGGCGTATCGGGAGCAGCCGCTGCCAGCCCAGGACCCAGTGTCGGTGAAGGAGGAGCCGGAAGC
AGAGGTGCGCATGGTGAATGGGAAGCCCAAGAAGGTCCGAAAGCCGCGTACAATCTACTCCAGCTACCAG
CTGGCCGCCCTGCAGCGCCGCTTCCAGAAGGCCCAGTACCTGGCGCTGCCCGAGCGCGCCGAGCTGGCCG
CGCAGCTGGGCCTCACGCAGACACAGGTGAAAATCTGGTTCCAGAACCGCCGTTCCAAGTTCAAGAAACT
CTACAAGAACGGGGAGGTGCCGCTGGAGCACAGTCCCAATAACAGTGATTCCATGGCCTGCAACTCACCA
CCATCACCCGCCCTCTGGGACACCTCTTCCCACTCCACTCCGGCCCCTGCCCGCAGTCAGCTGCCCCCGC
CGCTCCCATACAGTGCCTCCCCCAGCTACCTGGACGACCCCACCAACTCCTGGTATCACGCACAGAACCT
GAGTGGACCCCACTTACAGCAGCAGCCGCCTCAGCCAGCCACCCTGCACCATGCCTCTCCCGGGCCCCCG
CCCAACCCTGGGGCTGTGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205795 protein sequence
Red=Cloning site Green=Tags(s)

MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFN
LNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQ
LAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSP
PSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP
PNPGAVY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005220
ORF Size 861 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005220.1
RefSeq Size 2613 bp
RefSeq ORF 864 bp
Locus ID 1747
UniProt ID O60479
Cytogenetics 17q21.33
Domains homeobox
Protein Families Druggable Genome, Transcription Factors
MW 31.7 kDa
Gene Summary Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.