Stromal interaction molecule 1 (STIM1) (NM_003156) Human Tagged ORF Clone

CAT#: RC205678

Reviews ()
Write a review

STIM1 (Myc-DDK-tagged)-Human stromal interaction molecule 1 (STIM1)



Reconstitution Protocol

USD 941.00

In Stock*

Size
    • 10 ug

Product images

Other products for "STIM1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol STIM1
Synonyms D11S4896E; GOK; IMD10; STRMK; TAM; TAM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205678 representing NM_003156
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGCCAGAGCCTCA
GCCATAGTCACAGTGAGAAGGCGACAGGAACCAGCTCGGGGGCCAACTCTGAGGAGTCCACTGCAGCAGA
GTTTTGCCGAATTGACAAGCCCCTGTGTCACAGTGAGGATGAGAAACTCAGCTTCGAGGCAGTCCGTAAC
ATCCACAAACTGATGGACGATGATGCCAATGGTGATGTGGATGTGGAAGAAAGTGATGAGTTCCTGAGGG
AAGACCTCAATTACCATGACCCAACAGTGAAACACAGCACCTTCCATGGTGAGGATAAGCTCATCAGCGT
GGAGGACCTGTGGAAGGCATGGAAGTCATCAGAAGTATACAATTGGACCGTGGATGAGGTGGTACAGTGG
CTGATCACATATGTGGAGCTGCCTCAGTATGAGGAGACCTTCCGGAAGCTGCAGCTCAGTGGCCATGCCA
TGCCAAGGCTGGCTGTCACCAACACCACCATGACAGGGACTGTGCTGAAGATGACAGACCGGAGTCATCG
GCAGAAGCTGCAGCTGAAGGCTCTGGATACAGTGCTCTTTGGGCCTCCTCTCTTGACTCGCCATAATCAC
CTCAAGGACTTCATGCTGGTGGTGTCTATCGTTATTGGTGTGGGCGGCTGCTGGTTTGCCTATATCCAGA
ACCGTTACTCCAAGGAGCACATGAAGAAGATGATGAAGGACTTGGAGGGGTTACACCGAGCTGAGCAGAG
TCTGCATGACCTTCAGGAAAGGCTGCACAAGGCCCAGGAGGAGCACCGCACAGTGGAGGTGGAGAAGGTC
CATCTGGAAAAGAAGCTGCGCGATGAGATCAACCTTGCTAAGCAGGAAGCCCAGCGGCTGAAGGAGCTGC
GGGAGGGTACTGAGAATGAGCGGAGCCGCCAAAAATATGCTGAGGAGGAGTTGGAGCAGGTTCGGGAGGC
CTTGAGGAAAGCAGAGAAGGAGCTAGAATCTCACAGCTCATGGTATGCTCCAGAGGCCCTTCAGAAGTGG
CTGCAGCTGACACATGAGGTGGAGGTGCAATATTACAACATCAAGAAGCAAAATGCTGAGAAGCAGCTGC
TGGTGGCCAAGGAGGGGGCTGAGAAGATAAAAAAGAAGAGAAACACACTCTTTGGCACCTTCCACGTGGC
CCACAGCTCTTCCCTGGATGATGTAGATCATAAAATTCTAACAGCTAAGCAAGCACTGAGCGAGGTGACA
GCAGCATTGCGGGAGCGCCTGCACCGCTGGCAACAGATCGAGATCCTCTGTGGCTTCCAGATTGTCAACA
ACCCTGGCATCCACTCACTGGTGGCTGCCCTCAACATAGACCCCAGCTGGATGGGCAGTACACGCCCCAA
CCCTGCTCACTTCATCATGACTGACGACGTGGATGACATGGATGAGGAGATTGTGTCTCCCTTGTCCATG
CAGTCCCCTAGCCTGCAGAGCAGTGTTCGGCAGCGCCTGACGGAGCCACAGCATGGCCTGGGATCTCAGA
GGGATTTGACCCATTCCGATTCGGAGTCCTCCCTCCACATGAGTGACCGCCAGCGTGTGGCCCCCAAACC
TCCTCAGATGAGCCGTGCTGCAGACGAGGCTCTCAATGCCATGACTTCCAATGGCAGCCACCGGCTGATC
GAGGGGGTCCACCCAGGGTCTCTGGTGGAGAAACTGCCTGACAGCCCTGCCCTGGCCAAGAAGGCATTAC
TGGCGCTGAACCATGGGCTGGACAAGGCCCACAGCCTGATGGAGCTGAGCCCCTCAGCCCCACCTGGTGG
CTCTCCACATTTGGATTCTTCCCGTTCTCACAGCCCCAGCTCCCCAGACCCAGACACACCATCTCCAGTT
GGGGACAGCCGAGCCCTGCAAGCCAGCCGAAACACACGCATTCCCCACCTGGCTGGCAAGAAGGCTGTGG
CTGAGGAGGATAATGGCTCTATTGGCGAGGAAACAGACTCCAGCCCAGGCCGGAAGAAGTTTCCCCTCAA
AATCTTTAAGAAGCCTCTTAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205678 representing NM_003156
Red=Cloning site Green=Tags(s)

MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRN
IHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNH
LKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKV
HLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKW
LQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSM
QSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLI
EGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPV
GDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003156
ORF Size 2055 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003156.4
RefSeq Size 4039 bp
RefSeq ORF 2058 bp
Locus ID 6786
UniProt ID Q13586
Cytogenetics 11p15.4
Protein Families Transmembrane
MW 77.42 kDa
Gene Summary This gene encodes a type 1 transmembrane protein that mediates Ca2+ influx after depletion of intracellular Ca2+ stores by gating of store-operated Ca2+ influx channels (SOCs). It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region, as well as early hematopoiesis, by mediating attachment to stromal cells. Mutations in this gene are associated with fatal classic Kaposi sarcoma, immunodeficiency due to defects in store-operated calcium entry (SOCE) in fibroblasts, ectodermal dysplasia and tubular aggregate myopathy. This gene is oriented in a head-to-tail configuration with the ribonucleotide reductase 1 gene (RRM1), with the 3' end of this gene situated 1.6 kb from the 5' end of the RRM1 gene. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.