Calpain 2 (CAPN2) (NM_001748) Human Tagged ORF Clone

CAT#: RC205642

Reviews ()
Write a review

CAPN2 (Myc-DDK-tagged)-Human calpain 2, (m/II) large subunit (CAPN2), transcript variant 1



  "NM_001748" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CAPN2
Synonyms CANP2; CANPL2; CANPml; mCANP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205642 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCATCGCGGCCAAGCTGGCGAAGGACCGGGAGGCGGCCGAGGGGCTGGGCTCCCACGAGAGGG
CCATCAAGTACCTCAACCAGGACTACGAGGCGCTGCGGAACGAGTGCCTGGAGGCCGGGACGCTCTTCCA
GGACCCGTCCTTCCCGGCCATCCCCTCGGCCCTGGGCTTCAAGGAGTTGGGGCCCTACTCCAGCAAAACC
CGGGGCATCGAGTGGAAGCGCCCCACGGAGATCTGCGCTGACCCCCAGTTTATCATTGGAGGAGCCACCC
GCACAGACATCTGCCAAGGAGCCCTAGGTGACTGCTGGCTGCTGGCAGCCATTGCCTCCCTCACCTTGAA
TGAAGAAATCCTGGCTCGAGTCGTCCCCCTAAACCAGAGCTTCCAGGAAAACTATGCAGGGATCTTTCAC
TTCCAGTTCTGGCAATACGGCGAGTGGGTGGAGGTGGTGGTGGATGACAGGCTGCCCACCAAGGACGGGG
AGCTGCTCTTTGTGCATTCAGCCGAAGGGAGCGAGTTCTGGAGCGCCCTGCTGGAGAAGGCATACGCCAA
GATCAACGGATGCTATGAAGCACTATCAGGGGGTGCCACCACTGAGGGCTTCGAAGACTTCACCGGAGGC
ATTGCTGAGTGGTATGAGTTGAAGAAGCCCCCTCCCAACCTGTTCAAGATCATCCAGAAAGCTCTGCAAA
AAGGCTCTCTCCTTGGCTGCTCCATCGACATCACCAGCGCCGCGGACTCGGAGGCCATCACGTTTCAGAA
GCTGGTGAAGGGGCACGCGTACTCGGTCACCGGAGCCGAGGAGGTTGAAAGTAACGGAAGCCTACAGAAA
CTGATCCGCATCCGAAATCCCTGGGGAGAAGTGGAGTGGACAGGGCGGTGGAATGACAACTGCCCAAGCT
GGAACACTATAGACCCAGAGGAGAGGGAAAGGCTGACCAGACGGCATGAAGATGGAGAATTCTGGATGTC
TTTCAGTGACTTCCTGAGGCACTATTCCCGCCTGGAGATCTGTAACCTGACCCCAGACACTCTCACCAGC
GATACCTACAAGAAGTGGAAACTCACCAAAATGGATGGGAACTGGAGGCGGGGCTCCACCGCGGGAGGTT
GCAGGAACTACCCGAACACATTCTGGATGAACCCTCAGTACCTGATCAAGCTGGAGGAGGAGGATGAGGA
CGAGGAGGATGGGGAGAGCGGCTGCACCTTCCTGGTGGGGCTCATTCAGAAGCACCGACGGCGGCAGAGG
AAGATGGGCGAGGACATGCACACCATCGGCTTTGGCATCTATGAGGTTCCAGAGGAGTTAAGTGGGCAGA
CCAACATCCACCTCAGCAAAAACTTCTTCCTGACGAATCGCGCCAGGGAGCGCTCAGACACCTTCATCAA
CCTCCGGGAGGTGCTCAACCGCTTCAAGCTGCCGCCAGGAGAGTACATTCTCGTGCCTTCCACCTTCGAA
CCCAACAAGGATGGGGATTTCTGCATCCGGGTCTTTTCTGAAAAGAAAGCTGACTACCAAGCTGTCGATG
ATGAAATCGAGGCCAATCTTGAAGAGTTCGACATCAGCGAGGATGACATTGATGATGGATTCAGGAGACT
GTTTGCCCAGTTGGCAGGAGAGGATGCGGAGATCTCTGCCTTTGAGCTGCAGACCATCCTGAGAAGGGTT
CTAGCAAAGCGCCAAGATATCAAGTCAGATGGCTTCAGCATCGAGACATGCAAAATTATGGTTGACATGC
TAGATTCGGACGGGAGTGGCAAGCTGGGGCTGAAGGAGTTCTACATTCTCTGGACGAAGATTCAAAAATA
CCAAAAAATTTACCGAGAAATCGACGTTGACAGGTCTGGTACCATGAATTCCTATGAAATGCGGAAGGCA
TTAGAAGAAGCAGGTTTCAAGATGCCCTGTCAACTCCACCAAGTCATCGTTGCTCGGTTTGCAGATGACC
AGCTCATCATCGATTTTGATAATTTTGTTCGGTGTTTGGTTCGGCTGGAAACGCTATTCAAGATATTTAA
GCAGCTGGATCCCGAGAATACTGGAACAATAGAGCTCGACCTTATCTCTTGGCTCTGTTTCTCAGTACTT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC205642 protein sequence
Red=Cloning site Green=Tags(s)

MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKT
RGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFH
FQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGG
IAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQK
LIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS
DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFE
PNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRV
LAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKA
LEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001748
ORF Size 2100 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001748.5
RefSeq Size 3492 bp
RefSeq ORF 2103 bp
Locus ID 824
UniProt ID P17655
Cytogenetics 1q41
Domains Calpain_III, EFh
Protein Families Druggable Genome, Protease
Protein Pathways Alzheimer's disease, Apoptosis, Focal adhesion
MW 80 kDa
Gene Summary The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Other Versions

Other products for "CAPN2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


CAPN2 (Calpain 2) mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
    • 100 ul

USD 417.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.