ABCG2 (NM_004827) Human Tagged ORF Clone

CAT#: RC205640

Reviews ()
Write a review
  • TrueORF®

ABCG2 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family G (WHITE), member 2 (ABCG2)



  "NM_004827" in other vectors (7)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ABCG2 (NM_004827) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ABCG2
Synonyms ABC15; ABCP; BCRP; BCRP1; BMDP; CD338; CDw338; EST157481; GOUT1; MRX; MXR; MXR-1; MXR1; UAQTL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205640 representing NM_004827
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCCAGTAATGTCGAAGTTTTTATCCCAGTGTCACAAGGAAACACCAATGGCTTCCCCGCGACAG
CTTCCAATGACCTGAAGGCATTTACTGAAGGAGCTGTGTTAAGTTTTCATAACATCTGCTATCGAGTAAA
ACTGAAGAGTGGCTTTCTACCTTGTCGAAAACCAGTTGAGAAAGAAATATTATCGAATATCAATGGGATC
ATGAAACCTGGTCTCAACGCCATCCTGGGACCCACAGGTGGAGGCAAATCTTCGTTATTAGATGTCTTAG
CTGCAAGGAAAGATCCAAGTGGATTATCTGGAGATGTTCTGATAAATGGAGCACCGCGACCTGCCAATTT
CAAATGTAATTCAGGTTACGTGGTACAAGATGATGTTGTGATGGGCACTCTGACGGTGAGAGAAAACTTA
CAGTTCTCAGCAGCTCTTCGGCTTGCAACAACTATGACGAATCATGAAAAAAACGAACGGATTAACAGGG
TCATTCAAGAGTTAGGTCTGGATAAAGTGGCAGACTCCAAGGTTGGAACTCAGTTTATCCGTGGTGTGTC
TGGAGGAGAAAGAAAAAGGACTAGTATAGGAATGGAGCTTATCACTGATCCTTCCATCTTGTTCTTGGAT
GAGCCTACAACTGGCTTAGACTCAAGCACAGCAAATGCTGTCCTTTTGCTCCTGAAAAGGATGTCTAAGC
AGGGACGAACAATCATCTTCTCCATTCATCAGCCTCGATATTCCATCTTCAAGTTGTTTGATAGCCTCAC
CTTATTGGCCTCAGGAAGACTTATGTTCCACGGGCCTGCTCAGGAGGCCTTGGGATACTTTGAATCAGCT
GGTTATCACTGTGAGGCCTATAATAACCCTGCAGACTTCTTCTTGGACATCATTAATGGAGATTCCACTG
CTGTGGCATTAAACAGAGAAGAAGACTTTAAAGCCACAGAGATCATAGAGCCTTCCAAGCAGGATAAGCC
ACTCATAGAAAAATTAGCGGAGATTTATGTCAACTCCTCCTTCTACAAAGAGACAAAAGCTGAATTACAT
CAACTTTCCGGGGGTGAGAAGAAGAAGAAGATCACAGTCTTCAAGGAGATCAGCTACACCACCTCCTTCT
GTCATCAACTCAGATGGGTTTCCAAGCGTTCATTCAAAAACTTGCTGGGTAATCCCCAGGCCTCTATAGC
TCAGATCATTGTCACAGTCGTACTGGGACTGGTTATAGGTGCCATTTACTTTGGGCTAAAAAATGATTCT
ACTGGAATCCAGAACAGAGCTGGGGTTCTCTTCTTCCTGACGACCAACCAGTGTTTCAGCAGTGTTTCAG
CCGTGGAACTCTTTGTGGTAGAGAAGAAGCTCTTCATACATGAATACATCAGCGGATACTACAGAGTGTC
ATCTTATTTCCTTGGAAAACTGTTATCTGATTTATTACCCATGAGGATGTTACCAAGTATTATATTTACC
TGTATAGTGTACTTCATGTTAGGATTGAAGCCAAAGGCAGATGCCTTCTTCGTTATGATGTTTACCCTTA
TGATGGTGGCTTATTCAGCCAGTTCCATGGCACTGGCCATAGCAGCAGGTCAGAGTGTGGTTTCTGTAGC
AACACTTCTCATGACCATCTGTTTTGTGTTTATGATGATTTTTTCAGGTCTGTTGGTCAATCTCACAACC
ATTGCATCTTGGCTGTCATGGCTTCAGTACTTCAGCATTCCACGATATGGATTTACGGCTTTGCAGCATA
ATGAATTTTTGGGACAAAACTTCTGCCCAGGACTCAATGCAACAGGAAACAATCCTTGTAACTATGCAAC
ATGTACTGGCGAAGAATATTTGGTAAAGCAGGGCATCGATCTCTCACCCTGGGGCTTGTGGAAGAATCAC
GTGGCCTTGGCTTGTATGATTGTTATTTTCCTCACAATTGCCTACCTGAAATTGTTATTTCTTAAAAAAT
ATTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205640 representing NM_004827
Red=Cloning site Green=Tags(s)

MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGI
MKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENL
QFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLD
EPTTGLDSSTANAVLLLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESA
GYHCEAYNNPADFFLDIINGDSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELH
QLSGGEKKKKITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLPMRMLPSIIFT
CIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLLMTICFVFMMIFSGLLVNLTT
IASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH
VALACMIVIFLTIAYLKLLFLKKYS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004827
ORF Size 1965 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004827.1, NM_004827.2, NP_004818.2
RefSeq Size 4445 bp
RefSeq ORF 1968 bp
Locus ID 9429
Cytogenetics 4q22.1
Domains ABC_tran, AAA
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways ABC transporters
MW 72.1 kDa
Gene Summary The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Citations (1)

Other Versions

Other products for "ABCG2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Mouse Monoclonal ABCG2/CD338 Antibody (3G8)
    • 100 ul

USD 465.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools