ARL15 (NM_019087) Human Tagged ORF Clone

CAT#: RC205610

ARL15 (Myc-DDK-tagged)-Human ADP-ribosylation factor-like 15 (ARL15)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARL15 (NM_019087) Human Tagged ORF Clone
Symbol ARL15
Synonyms ARFRP2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205610 representing NM_019087
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGATCTCCGGATAACTGAGGCGTTTCTGTACATGGATTATCTGTGTTTTAGAGCACTTTGCTGCA
AGGGACCACCACCTGCACGACCAGAATATGACCTGGTTTGCATAGGCCTCACAGGTTCTGGCAAAACCAG
TCTGTTGTCCAAACTCTGCAGTGAAAGCCCCGATAACGTCGTGTCGACCACAGGTTTTAGTATTAAAGCA
GTGCCATTCCAGAATGCCATCTTGAATGTAAAAGAACTTGGAGGGGCTGATAACATCCGGAAATACTGGA
GCCGCTACTACCAAGGATCTCAAGGGGTAATATTTGTATTAGACAGTGCCTCTTCAGAGGATGATTTAGA
AGCTGCTAGAAATGAGCTGCACTCAGCTCTTCAGCATCCACAGTTATGCACTTTACCCTTTTTAATATTG
GCCAATCATCAAGACAAGCCAGCAGCTCGCTCAGTACAAGAGATCAAAAAATATTTTGAACTTGAACCAC
TTGCACGTGGAAAACGCTGGATTCTACAGCCCTGCTCACTGGATGACATGGATGCACTGAAAGACAGCTT
CTCTCAGCTGATTAATTTGTTAGAAGAAAAAGACCATGAAGCTGTAAGAATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205610 representing NM_019087
Red=Cloning site Green=Tags(s)

MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKA
VPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLIL
ANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019087
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019087.1, NM_019087.2, NP_061960
RefSeq Size 2501
RefSeq ORF 615
Locus ID 54622
Cytogenetics 5q11.2
Domains SAR, ARF, arf
MW 22.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)