ANKRD1 (NM_014391) Human Tagged ORF Clone

CAT#: RC205609

ANKRD1 (Myc-DDK-tagged)-Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ANKRD1 (NM_014391) Human Tagged ORF Clone
Symbol ANKRD1
Synonyms ALRP; bA320F15.2; C-193; CARP; CVARP; MCARP
Vector pCMV6-Entry
Sequence Data
>RC205609 representing NM_014391
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGTACTGAAAGTAGAGGAACTGGTCACTGGAAAGAAGAATGGCAATGGGGAGGCAGGGGAATTCC
TTCCTGAGGATTTCAGAGATGGAGAGTATGAAGCTGCTGTTACTTTAGAGAAGCAGGAGGATCTGAAGAC
ACTTCTAGCCCACCCTGTGACCCTGGGGGAGCAACAGTGGAAAAGCGAGAAACAACGAGAGGCAGAGCTC
AAAAAGAAAAAACTAGAACAAAGATCAAAGCTTGAAAATTTAGAAGACCTTGAAATAATCATTCAACTGA
AGAAAAGGAAAAAATACAGGAAAACTAAAGTTCCAGTTGTAAAGGAACCAGAACCTGAAATCATTACGGA
ACCTGTGGATGTGCCTACGTTTCTGAAGGCTGCTCTGGAGAATAAACTGCCAGTAGTAGAAAAATTCTTG
TCAGACAAGAACAATCCAGATGTTTGTGATGAGTATAAACGGACAGCTCTTCATAGAGCATGCTTGGAAG
GACATTTGGCAATTGTGGAGAAGTTAATGGAAGCTGGAGCCCAGATCGAATTCCGTGATATGCTTGAATC
CACAGCCATCCACTGGGCAAGCCGTGGAGGAAACCTGGATGTTTTAAAATTGTTGCTGAATAAAGGAGCA
AAAATTAGCGCCCGAGATAAGTTGCTCAGCACAGCGCTGCATGTGGCGGTGAGGACTGGCCACTATGAGT
GCGCGGAGCATCTTATCGCCTGTGAGGCAGACCTCAACGCCAAAGACAGAGAAGGAGATACCCCGTTGCA
TGATGCGGTGAGACTGAACCGCTATAAGATGATCCGACTCCTGATTATGTATGGCGCGGATCTCAACATC
AAGAACTGTGCTGGGAAGACGCCGATGGATCTGGTGCTACACTGGCAGAATGGAACCAAAGCAATATTCG
ACAGCCTCAGAGAGAACTCCTACAAGACCTCTCGCATAGCTACATTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205609 representing NM_014391
Red=Cloning site Green=Tags(s)

MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAEL
KKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFL
SDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGA
KISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNI
KNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014391
ORF Size 957 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014391.1, NM_014391.2, NP_055206
RefSeq Size 1994
RefSeq ORF 960
Locus ID 27063
Cytogenetics 10q23.31
MW 36.1 kDa
Gene Summary The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)