ZNF165 (NM_003447) Human Tagged ORF Clone

CAT#: RC205600

Reviews ()
Write a review

ZNF165 (Myc-DDK-tagged)-Human zinc finger protein 165 (ZNF165)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ZNF165"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZNF165
Synonyms CT53; LD65; ZSCAN7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205600 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACAGAACCAAAGAAAGCTGCAGCCCAGAACTCTCCAGAGGATGAAGGACTTCTGATAGTGAAGA
TAGAAGAGGAAGAATTTATCCATGGGCAGGACACTTGCTTACAGAGAAGTGAACTCCTTAAGCAGGAGCT
CTGCAGGCAGCTTTTTAGGCAGTTCTGCTACCAGGATTCTCCTGGACCTCGCGAGGCACTGAGCCGCCTC
CGGGAGCTCTGCTGTCAGTGGCTGAAGCCAGAGATCCATACCAAGGAACAGATTCTGGAACTGCTGGTGC
TAGAGCAGTTCCTGACCATCCTGCCAGGAGATTTGCAGGCCTGGGTACATGAACATTACCCAGAGAGTGG
AGAGGAGGCAGTGACCATACTAGAAGATTTGGAGAGAGGCACTGATGAAGCAGTACTCCAGGTTCAAGCC
CATGAACATGGACAAGAAATATTCCAGAAAAAAGTGTCACCTCCTGGACCAGCACTTAATGTCAAGTTAC
AGCCAGTGGAGACCAAGGCCCATTTTGATTCATCAGAACCCCAGCTCCTATGGGACTGTGATAATGAGAG
TGAAAACAGTAGATCCATGCCAAAGCTGGAAATTTTTGAAAAAATTGAATCACAGAGAATTATATCTGGA
AGAATCTCAGGATACATATCAGAAGCGTCTGGTGAGTCTCAAGACATCTGTAAGTCTGCAGGCAGGGTAA
AGAGACAATGGGAAAAAGAATCAGGGGAGTCTCAGAGACTCTCGTCTGCCCAGGATGAAGGTTTTGGTAA
AATCCTCACCCACAAAAATACAGTCAGAGGTGAAATAATAAGCCACGATGGATGTGAGAGGAGATTAAAT
CTGAACTCAAATGAATTCACACACCAGAAATCTTGTAAACATGGTACCTGTGACCAGAGCTTCAAATGGA
ACTCAGATTTTATTAACCATCAAATAATTTATGCTGGAGAAAAAAATCACCAATATGGAAAATCTTTCAA
GAGCCCAAAACTTGCTAAACATGCAGCAGTTTTCAGTGGAGATAAAACTCATCAGTGTAATGAATGTGGG
AAAGCTTTCAGGCACAGCTCAAAACTTGCTAGGCATCAGAGAATCCACACTGGAGAGAGATGCTATGAAT
GTAATGAATGTGGGAAAAGCTTTGCAGAGAGCTCAGATCTTACTAGACATCGGCGAATTCACACTGGGGA
AAGACCCTTTGGTTGCAAAGAATGTGGGAGAGCATTCAACCTGAACTCACATCTTATCAGGCATCAGAGA
ATTCACACCAGAGAGAAACCCTACGAGTGTAGTGAATGTGGGAAAACCTTCCGAGTGAGCTCACATCTTA
TTCGACACTTTAGAATTCACACTGGAGAAAAACCCTATGAATGCAGTGAGTGTGGAAGAGCCTTCAGTCA
GAGCTCAAACCTTAGTCAACACCAGAGAATTCACATGAGGGAAAACCTATTAATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205600 protein sequence
Red=Cloning site Green=Tags(s)

MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDSPGPREALSRL
RELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEAVTILEDLERGTDEAVLQVQA
HEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLLWDCDNESENSRSMPKLEIFEKIESQRIISG
RISGYISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLN
LNSNEFTHQKSCKHGTCDQSFKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECG
KAFRHSSKLARHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMRENLLM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003447
ORF Size 1455 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003447.4
RefSeq Size 2411 bp
RefSeq ORF 1458 bp
Locus ID 7718
UniProt ID P49910
Cytogenetics 6p22.1
Protein Families Stem cell - Pluripotency, Transcription Factors
MW 55.8 kDa
Gene Summary This gene encodes a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. This gene is located within a cluster of zinc finger family members. The encoded protein may play a role in spermatogenesis. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.