ADO (NM_032804) Human Tagged ORF Clone

CAT#: RC205583

Reviews ()
Write a review

ADO (Myc-DDK-tagged)-Human 2-aminoethanethiol (cysteamine) dioxygenase (ADO)

  View "NM_032804" in other vectors (10)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 500.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADO (NM_032804) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADO
Synonyms C10orf22
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205583 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCGAGACAACATGGCCTCCTTGATCCAACGGATCGCCCGCCAGGCTTGCCTCACCTTCCGGGGCA
GCTGGGGCGGCCGCGGCGCTTCCGATCGCGACGCGGCTTCTGGCGCGGAGGCGCCGATGCAGCCGGGCTT
CCCCGAGAACCTGAGCAAGCTGAAGAGCCTCCTGACCCAGCTCCGCGCCGAGGACTTGAACATCGCCCCG
CGCAAGGCCACACTGCAGCCGCTGCCGCCCAACCTGCCGCCAGTCACCTACATGCACATCTACGAGACGG
ACGGCTTCAGCCTGGGCGTGTTCCTGCTCAAGAGCGGCACGTCCATCCCGCTGCACGACCACCCGGGCAT
GCACGGCATGCTCAAGGTGCTGTACGGCACCGTGCGCATCAGCTGCATGGACAAGCTAGACGCGGGCGGC
GGGCAACGGCCGCGGGCCTTGCCGCCCGAGCAGCAGTTCGAGCCGCCGCTGCAGCCCCGGGAGCGAGAAG
CCGTGCGGCCGGGCGTGCTGCGTTCGCGGGCCGAGTACACCGAGGCCAGCGGCCCCTGCATCCTCACACC
GCACCGGGACAACCTGCACCAGATCGACGCCGTGGAAGGGCCTGCCGCCTTCCTGGACATCCTGGCCCCG
CCCTACGACCCGGACGATGGCCGGGACTGCCACTATTACCGGGTGCTGGAGCCGGTCAGGCCCAAGGAGG
CCTCCAGCTCGGCCTGTGACCTGCCTCGAGAGGTGTGGCTCCTGGAGACCCCACAGGCCGATGACTTCTG
GTGCGAGGGAGAACCCTATCCAGGTCCCAAGGTCTTCCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205583 protein sequence
Red=Cloning site Green=Tags(s)

MPRDNMASLIQRIARQACLTFRGSWGGRGASDRDAASGAEAPMQPGFPENLSKLKSLLTQLRAEDLNIAP
RKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGG
GQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAP
PYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032804
ORF Size 810 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032804.5, NP_116193.2
RefSeq Size 3739
RefSeq ORF 813
Locus ID 84890
Cytogenetics 10q21.3
Protein Pathways Metabolic pathways, Taurine and hypotaurine metabolism
MW 29.9 kDa
Gene Summary Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine (Dominy et al., 2007 [PubMed 17581819]). [supplied by OMIM, Mar 2008]

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Anti-ADO Rabbit Polyclonal Antibody
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones