SLC22A15 (NM_018420) Human Tagged ORF Clone

CAT#: RC205541

Reviews ()
Write a review

SLC22A15 (Myc-DDK-tagged)-Human solute carrier family 22, member 15 (SLC22A15)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 498.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC22A15
Synonyms FLIPT1; PRO34686
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205541 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCATCTACCAGATGTACTTGTGCTTCCTGCTGGCCGTGCTGCTGCAGCTCTACGTGGCCACGGAGG
CCATCCTCATTGCACTGGTTGGGGCCACGCCATCCTACCACTGGGACCTGGCAGAGCTCCTGCCAAATCA
GAGCCACGGTAACCAGTCAGCTGGTGAAGACCAGGCCTTTGGGGACTGGCTCCTGACAGCCAACGGCAGT
GAGATCCATAAGCACGTGCATTTCAGCAGCAGCTTCACCTCCATCGCCTCGGAGTGGTTTTTAATTGCCA
ACAGATCCTACAAAGTCAGTGCAGCAAGCTCTTTTTTCTTCAGTGGTGTATTTGTTGGAGTTATCTCTTT
TGGTCAGCTTTCAGATCGCTTCGGAAGGAAAAAAGTCTATCTCACAGGTTTTGCTCTTGACATCTTATTT
GCAATTGCAAATGGATTTTCCCCCTCATATGAGTTCTTTGCAGTAACTCGCTTCCTGGTGGGCATGATGA
ATGGAGGGATGTCGCTGGTGGCCTTTGTCTTGCTTAATGAGTGTGTGGGCACCGCCTACTGGGCACTTGC
AGGATCGATTGGCGGCCTCTTCTTTGCAGTTGGCATTGCCCAATATGCCCTGTTAGGATACTTCATCCGC
TCCTGGAGGACCCTAGCCATTCTGGTTAACCTGCAGGGAACGGTGGTCTTTCTCTTATCTTTATTCATTC
CTGAATCACCTCGTTGGTTATACTCCCAGGGTCGACTGAGTGAGGCTGAAGAGGCGCTGTACCTCATTGC
CAAGAGGAACCGCAAACTCAAGTGCACGTTCTCACTAACACACCCAGCCAACAGGAGCTGCAGGGAGACT
GGAAGTTTCCTGGATCTCTTTCGTTACCGGGTCCTGTTAGGACACACTTTGATCCTGATGTTCATCTGGT
TTGTGTGCAGCTTGGTGTATTATGGCCTAACTCTGAGTGCGGGTGATCTAGGTGGAAGTATTTATGCCAA
CCTGGCCCTGTCTGGCCTCATAGAGATTCAATCTTACCCTCTCTGTATCTACTTGATTAACCAAAAATGG
TTTGGTCGGAAGCGAACATTATCAGCATTTCTGTGCCTAGGAGGACTGGCTTGTCTTATTGTAATGTTTC
TTCCAGAAAAGAAAGACACAGGTGTGTTTGCAGTGGTGAACAGCCATTCCTTGTCCTTGCTGGGGAAGCT
GACCATCAGTGCTGCCTTTAACATTGTTTATATCTACACCTCTGAGCTTTACCCTACAGTCATCAGGAAT
GTTGGGCTTGGAACTTGTTCCATGTTCTCCCGAGTTGGTGGGATTATTGCTCCCTTCATCCCCTCACTGA
AATATGTGCAATGGTCTTTACCATTCATTGTCTTCGGAGCCACGGGTCTGACCTCCGGCCTCCTGAGTTT
GTTATTGCCGGAGACCCTTAACAGTCCGCTGCTAGAAACATTCTCCGACCTTCAGGTGTATTCGTATCGC
AGGCTGGGAGAAGAAGCATTATCTTTACAGGCTTTGGACCCCCAACAGTGTGTGGACAAGGAGAGCTCTT
TAGGGAGTGAGAGTGAGGAAGAGGAAGAATTTTATGATGCAGATGAAGAGACTCAGATGATCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205541 protein sequence
Red=Cloning site Green=Tags(s)

MGIYQMYLCFLLAVLLQLYVATEAILIALVGATPSYHWDLAELLPNQSHGNQSAGEDQAFGDWLLTANGS
EIHKHVHFSSSFTSIASEWFLIANRSYKVSAASSFFFSGVFVGVISFGQLSDRFGRKKVYLTGFALDILF
AIANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIR
SWRTLAILVNLQGTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRET
GSFLDLFRYRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIQSYPLCIYLINQKW
FGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYIYTSELYPTVIRN
VGLGTCSMFSRVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYR
RLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018420
ORF Size 1605 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018420.1, NP_060890.1
RefSeq Size 4729 bp
RefSeq ORF 1644 bp
Locus ID 55356
UniProt ID Q8IZD6
Cytogenetics 1p13.1
Domains sugar_tr
Protein Families Transmembrane
MW 59.3 kDa
Gene Summary Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM, Apr 2004]
Other products for "SLC22A15"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.