EFHA1(MICU2) (NM_152726) Human Tagged ORF Clone

CAT#: RC205455

EFHA1 (Myc-DDK-tagged)-Human EF-hand domain family, member A1 (EFHA1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EFHA1(MICU2) (NM_152726) Human Tagged ORF Clone
Symbol MICU2
Synonyms 1110008L20Rik; EFHA1
Vector pCMV6-Entry
Sequence Data
>RC205455 representing NM_152726
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCTGCGGGTAGCTGCGCGCGGGTGGCGGCCTGGGGCGGAAAACTGCGACGGGGGCTCGCTG
TCAGCCGACAGGCTGTGCGGAGTCCCGGCCCCTTGGCAGCGGCAGTGGCCGGCGCGGCCCTGGCAGGAGC
AGGAGCGGCCTGGCACCACAGCCGCGTCAGTGTTGCGGCGCGGGATGGCAGTTTTACAGTCTCCGCACAG
AAAAATGTTGAACATGGAATAATATATATTGGGAAACCGTCTCTTCGTAAGCAGCGCTTCATGCAGTTTT
CTTCACTCGAACATGAAGGAGAATATTATATGACACCACGAGACTTCCTCTTCTCAGTGATGTTTGAGCA
AATGGAACGTAAAACTTCAGTCAAGAAGCTGACAAAAAAGGACATCGAGGATACACTGTCAGGGATCCAA
ACAGCTGGCTGTGGATCAACTTTTTTCAGAGACCTTGGCGATAAAGGGCTAATTTCATATACCGAGTATC
TTTTCTTGCTTACAATCCTCACTAAACCCCATTCTGGATTTCATGTTGCTTTTAAAATGCTGGATACAGA
TGGTAATGAGATGATTGAAAAAAGGGAATTTTTTAAGCTGCAGAAGATCATAAGTAAACAAGATGACTTG
ATGACAGTGAAAACTAATGAAACTGGATATCAGGAAGCAATAGTGAAAGAACCTGAAATTAACACAACTC
TTCAGATGCGTTTCTTTGGAAAAAGAGGACAAAGAAAACTTCATTATAAAGAATTTCGAAGATTTATGGA
AAATTTACAAACAGAGATTCAAGAAATGGAATTCCTTCAGTTTTCTAAAGGTTTGAGTTTCATGAGAAAA
GAAGACTTTGCAGAGTGGCTACTTTTTTTCACTAACACTGAAAATAAAGATATTTATTGGAAAAATGTGA
GAGAGAAGTTGTCAGCAGGAGAGAGCATTAGTTTGGATGAATTCAAGTCATTTTGCCATTTTACAACCCA
CTTGGAAGACTTTGCTATTGCCATGCAGATGTTCAGTTTAGCTCATCGTCCTGTCAGACTAGCGGAGTTT
AAGAGAGCTGTGAAAGTAGCAACAGGACAAGAACTCTCAAACAATATTTTGGACACTGTCTTTAAGATCT
TTGATTTGGATGGTGATGAATGTCTTAGTCATGAAGAGTTTCTTGGGGTGTTAAAAAACAGAATGCATCG
AGGTTTATGGGTACCACAACATCAGAGTATACAAGAATACTGGAAGTGTGTGAAGAAAGAAAGCATTAAA
GGAGTAAAAGAAGTCTGGAAACAAGCTGGAAAAGGTCTTTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205455 representing NM_152726
Red=Cloning site Green=Tags(s)

MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQ
KNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQ
TAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDL
MTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRK
EDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEF
KRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK
GVKEVWKQAGKGLF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_152726
ORF Size 1302 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_152726.1, NM_152726.2, NP_689939
RefSeq Size 1891
RefSeq ORF 1305
Locus ID 221154
Cytogenetics 13q12.11
Domains EFh
MW 49.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)