DPP10 (NM_020868) Human Tagged ORF Clone

CAT#: RC205435

Reviews ()
Write a review

DPP10 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 10 (non-functional) (DPP10), transcript variant 1



  "NM_020868" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 729.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "DPP10"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DPP10
Synonyms DPL2; DPPY; DPRP-3; DPRP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205435 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCAAACTGCCAGCGTGTCCCATCACATCAAGTGTCAACCCTCAAAAACAATCAAGGAACTGGGAA
GTAACAGCCCTCCACAGAGAAACTGGAAGGGAATTGCTATTGCTCTGCTGGTGATTTTAGTTGTATGCTC
ACTCATCACTATGTCAGTCATCCTCTTAACCCCAGATGAACTCACAAATTCGTCAGAAACCAGATTGTCT
TTGGAAGACCTCTTTAGGAAAGACTTTGTGCTTCACGATCCAGAGGCTCGGTGGATCAATGATACAGATG
TGGTGTATAAAAGCGAGAATGGACATGTCATTAAACTGAATATAGAAACAAATGCTACCACATTATTATT
GGAAAACACAACTTTTGTAACCTTCAAAGCATCAAGACATTCAGTTTCACCAGATTTAAAATATGTCCTT
CTGGCATATGATGTCAAACAGATTTTTCATTATTCATATACTGCTTCATATGTGATTTACAACATACACA
CTAGGGAAGTTTGGGAGTTAAATCCTCCAGAAGTAGAGGACTCCGTCTTGCAGTACGCGGCCTGGGGTGT
CCAAGGGCAGCAGCTGATTTATATTTTTGAAAATAATATCTACTATCAACCTGATATAAAGAGCAGTTCA
TTGCGACTGACATCTTCTGGAAAAGAAGAAATAATTTTTAATGGGATTGCTGACTGGTTATATGAAGAGG
AACTCCTGCATTCTCACATCGCCCACTGGTGGTCACCAGATGGAGAAAGACTTGCCTTCCTGATGATAAA
TGACTCTTTGGTACCCACCATGGTTATCCCTCGGTTTACTGGAGCGTTGTATCCCAAAGGAAAGCAGTAT
CCGTATCCTAAGGCAGGTCAAATGAACCCAACAATAAAATTATATGTTGTAAACCTGTATGGACCAACTC
ACACTTTGGAGCTCATGCCACCTGACAGCTTTAAATCAAGAGAATACTATATCACTATGGTTAAATGGGT
AAGCAATACCAAGACTGTGGTAAGATGGTTAAACCGAGCTCAGAACATCTCCATCCTCACAGTCTGTGAG
ACCACTACAGGTGCTTGTAGTAAAAAATATGAGATGACATCAGATACGTGGCTCTCTCAGCAGAATGAGG
AGCCCGTGTTTTCTAGAGACGGCAGCAAATTCTTTATGACAGTGCCTGTTAAGCAAGGGGGACGTGGAGA
ATTTCACCACATAGCTATGTTCCTCATCCAGAGTAAAAGTGAGCAAATTACCGTGCGGCATCTGACATCA
GGAAACTGGGAAGTGATAAAGATCTTGGCATACGATGAAACTACTCAAAAAATTTACTTTCTGAGCACTG
AATCTTCTCCCAGAGGAAGGCAGCTGTACAGTGCTTCTACTGAAGGATTATTGAATCGCCAATGCATTTC
ATGTAATTTCATGAAAGAACAATGTACATATTTTGATGCCAGTTTTAGTCCCATGAATCAACATTTCTTA
TTATTCTGTGAAGGTCCAAGGGTCCCAGTGGTCAGCCTACATAGTACGGACAACCCAGCAAAATATTTTA
TATTGGAAAGCAATTCTATGCTGAAGGAAGCTATCCTGAAGAAGAAGATAGGAAAGCCAGAAATTAAAAT
CCTTCATATTGACGACTATGAACTTCCTTTACAGTTGTCCCTTCCCAAAGATTTTATGGACCGAAACCAG
TATGCTCTTCTGTTAATAATGGATGAAGAACCAGGAGGCCAGCTGGTTACAGATAAGTTCCATATTGACT
GGGATTCCGTACTCATTGACATGGATAATGTCATTGTAGCAAGATTTGATGGCAGAGGAAGTGGATTCCA
GGGTCTGAAAATTTTGCAGGAGATTCATCGAAGATTAGGTTCAGTAGAAGTAAAGGACCAAATAACAGCT
GTGAAATTTTTGCTGAAACTGCCTTACATTGACTCCAAAAGATTAAGCATTTTTGGAAAGGGTTATGGTG
GCTATATTGCATCAATGATCTTAAAATCAGATGAAAAGCTTTTTAAATGTGGATCCGTGGTTGCACCTAT
CACAGACTTGAAATTGTATGCCTCAGCTTTCTCTGAAAGATACCTTGGGATGCCATCTAAGGAAGAAAGC
ACTTACCAGGCAGCCAGTGTGCTACATAATGTTCATGGCTTGAAAGAAGAAAATATATTAATAATTCATG
GAACTGCTGACACAAAAGTTCATTTCCAACACTCAGCAGAATTAATCAAGCACCTAATAAAAGCTGGAGT
GAATTATACTATGCAGGTCTACCCAGATGAAGGTCATAACGTATCTGAGAAGAGCAAGTATCATCTCTAC
AGCACAATCCTCAAATTCTTCAGTGATTGTTTGAAGGAAGAAATATCTGTGCTACCACAGGAACCAGAAG
AAGATGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205435 protein sequence
Red=Cloning site Green=Tags(s)

MNQTASVSHHIKCQPSKTIKELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDELTNSSETRLS
LEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKASRHSVSPDLKYVL
LAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQPDIKSSS
LRLTSSGKEEIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQY
PYPKAGQMNPTIKLYVVNLYGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCE
TTTGACSKKYEMTSDTWLSQQNEEPVFSRDGSKFFMTVPVKQGGRGEFHHIAMFLIQSKSEQITVRHLTS
GNWEVIKILAYDETTQKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFL
LFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEIKILHIDDYELPLQLSLPKDFMDRNQ
YALLLIMDEEPGGQLVTDKFHIDWDSVLIDMDNVIVARFDGRGSGFQGLKILQEIHRRLGSVEVKDQITA
VKFLLKLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEES
TYQAASVLHNVHGLKEENILIIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLY
STILKFFSDCLKEEISVLPQEPEEDE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020868
ORF Size 2388 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020868.1
RefSeq Size 5253 bp
RefSeq ORF 2391 bp
Locus ID 57628
UniProt ID Q8N608
Cytogenetics 2q14.1
Domains Peptidase_S9, DPPIV_N_term
Protein Families Druggable Genome, Protease, Transmembrane
MW 90.9 kDa
Gene Summary This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.