FGF12 (NM_004113) Human Tagged ORF Clone
CAT#: RC205427
FGF12 (Myc-DDK-tagged)-Human fibroblast growth factor 12 (FGF12), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_004113" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | FGF12 |
Synonyms | DEE47; EIEE47; FGF12B; FHF1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205427 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAGCAAAGAACCCCAGCTAAAAGGGATTGTGACAAGGTTATTCAGCCAGCAGGGATACTTCCTGC AGATGCACCCAGATGGTACCATTGATGGGACCAAGGACGAAAACAGCGACTACACTCTCTTCAATCTAAT TCCCGTGGGCCTGCGTGTAGTGGCCATCCAAGGAGTGAAGGCTAGCCTCTATGTGGCCATGAATGGTGAA GGCTATCTCTACAGTTCAGATGTTTTCACTCCAGAATGCAAATTCAAGGAATCTGTGTTTGAAAACTACT ATGTGATCTATTCTTCCACACTGTACCGCCAGCAAGAATCAGGCCGAGCTTGGTTTCTGGGACTCAATAA AGAAGGTCAAATTATGAAGGGGAACAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCGAAACCT ATTGAAGTGTGTATGTACAGAGAACAATCGCTACATGAAATTGGAGAAAAACAAGGGCGTTCAAGGAAAA GTTCTGGAACACCAACCATGAATGGAGGCAAAGTTGTGAATCAAGATTCAACA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205427 protein sequence
Red=Cloning site Green=Tags(s) MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGE GYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKP IEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_004113 |
ORF Size | 543 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004113.6 |
RefSeq Size | 5408 bp |
RefSeq ORF | 546 bp |
Locus ID | 2257 |
UniProt ID | P61328 |
Cytogenetics | 3q28-q29 |
Domains | FGF |
Protein Families | Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
MW | 20.5 kDa |
Gene Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. [provided by RefSeq, Dec 2019] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205427L3 | Lenti ORF clone of Human fibroblast growth factor 12 (FGF12), transcript variant 2, Myc-DDK-tagged |
USD 750.00 |
|
RC205427L4 | Lenti ORF clone of Human fibroblast growth factor 12 (FGF12), transcript variant 2, mGFP tagged |
USD 750.00 |
|
RG205427 | FGF12 (tGFP-tagged) - Human fibroblast growth factor 12 (FGF12), transcript variant 2 |
USD 650.00 |
|
SC108203 | FGF12 (untagged)-Human fibroblast growth factor 12 (FGF12), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review